Commit Graph

13255 Commits

Author SHA1 Message Date
Sven Neumann dfcc73ecb3 libgimp/libgimp-docs.sgml libgimp/libgimp-sections.txt
2004-08-30  Sven Neumann  <sven@gimp.org>

	* libgimp/libgimp-docs.sgml
	* libgimp/libgimp-sections.txt
	* libgimp/tmpl/gimpprogress.sgml
	* libgimpbase/libgimpbase-sections.txt
	* libgimpbase/tmpl/gimpbaseenums.sgml: updated for new progress API.
2004-08-30 15:36:28 +00:00
Sven Neumann 1901ac2ff3 fixed drawing of brushes that extend beyond the preview.
2004-08-30  Sven Neumann  <sven@gimp.org>

	* libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed
	drawing of brushes that extend beyond the preview.
2004-08-30 15:31:22 +00:00
Sven Neumann d1825782ea avoid excessive use of strdup() and strcmp(). The strings are all constant
2004-08-30  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
	avoid excessive use of strdup() and strcmp(). The strings are all
	constant anyway.
2004-08-30 15:08:02 +00:00
Michael Natterer 509b88e815 Brought the PDB progress into a working state. Fixes bug #6010, addressed
2004-08-30  Michael Natterer  <mitch@gimp.org>

	Brought the PDB progress into a working state. Fixes bug #6010,
	addressed bugs #97266 and #135185 and unfortunately reopens bug
	#150194 (will fix that later).

	* libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand.

	* app/core/gimppdbprogress.c
	* libgimp/gimpprogress.c: use the enum instead of integer
	constants for the different progress commands. Cleanup.

	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-in.c: switch bach to real refcouting for
	plug_in->progress (reopens bug #150194) and enabled the PDB
	progress code.

	* plug-ins/script-fu/script-fu-scripts.c: cleaned up the
	progress stuff and the script-fu interface a bit.

	* plug-ins/pygimp/gimpenums.py
	* plug-ins/script-fu/script-fu-constants.c
	* tools/pdbgen/enums.pl: regenerated.
2004-08-30 14:57:24 +00:00
Manish Singh 1c4395c5c7 set can_recurse on the recv_message watch, so we don't block on recursive
2004-08-29  Manish Singh  <yosh@gimp.org>

        * app/plug-in/plug-in.c (plug_in_open): set can_recurse on the
        recv_message watch, so we don't block on recursive calls to the
        handler. plug_in_recv_message needs some refcounting help now
        though.
2004-08-29 22:21:53 +00:00
Helvetix Victorinox ed055fa66f app/composite/gimp-composite-x86.h app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-x86.h
* app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-sse2.c: Fixed a bunch of
  warnings due to bad type casting.
2004-08-29 21:06:31 +00:00
Helvetix Victorinox cbdcd0ee54 app/composite/gimp-composite-mmx.c app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-mmx.c
* app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-x86.h
* app/composite/gimp-composite-sse2.c:
  The last changes to fix the the clobber registers bug #147013.
  Commented out some dead code to be reviewed later.
2004-08-29 20:07:06 +00:00
Michael Natterer 065db21d0a Added an API to allow plug-ins to embed the progress for the actions they
2004-08-29  Michael Natterer  <mitch@gimp.org>

	Added an API to allow plug-ins to embed the progress for the
	actions they trigger into their own GUI (attention: half-done and
	broken code ahead...)

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimppdbprogress.[ch]: new object implementing dispatching
	progress calls to a temporary PDB procedure in a plug-in.

	* app/Makefile.am: force to link gimppdbprogress.o, bah!

	* app/plug-in/plug-in-progress.[ch]: added API to install,
	uninstall and cancel a PDB progress for this plug-in, but disabled
	the implementation because it doesn't work yet.

	* tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new
	install, uninstall and cancel functions.

	* libgimp/Makefile.am
	* libgimp/gimp.h
	* libgimp/gimpprogress.[ch]: added an API around the PDB progress
	stuff.

	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* plug-ins/script-fu/script-fu-scripts.c: use the new API to show
	the progress in the script-fu dialog.
2004-08-29 18:36:30 +00:00
Michael Schumacher 3cb42821c2 added gimp_scale_entry_set_logarithmic
2004-08-29  Michael Schumacher <schumaml@cvs.gnome.org>

	* libgimpwidgets/gimpwidgets.def: added
	gimp_scale_entry_set_logarithmic
2004-08-29 12:32:43 +00:00
Sven Neumann bbe2c8ca3f forgot to commit the ChangeLog entry 2004-08-29 12:20:04 +00:00
Sven Neumann 8b9456f6f2 don't emit critical warnings about a messed up state of GimpConfigWriter
2004-08-29  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfigwriter.c: don't emit critical warnings
	about a messed up state of GimpConfigWriter if the writer is
	disabled because of a write error that occured earlier.
2004-08-29 12:13:34 +00:00
David Odin b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
Simon Budig 488bfe587f mention strftime in the Changelog entry. 2004-08-28 23:02:54 +00:00
Helvetix Victorinox 8a3bdf5297 app/composite/gimp-composite-sse.c More updates to accomodate the clobber
* app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-sse2.c: More updates to accomodate
  the clobber registers. Additional progress against bug #147013.

* app/composite/gimp-composite-sse.h: Fixed a bug where the wrong
  manifest constant definition caused sse2 instructions to never be
  compiled.
2004-08-28 21:21:07 +00:00
Sven Neumann d230b2289b fixed confusion about which mode to use when being run with last values
2004-08-28  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/vpropagate.c (run): fixed confusion about which
	mode to use when being run with last values (bug #151308).
2004-08-28 21:16:42 +00:00
Simon Budig 6fd46ff232 workaround to avoid a warning by gcc about the use of "%c" in the format
2004-08-28  Simon Budig  <simon@gimp.org>

	* plug-ins/common/plugindetails.c: workaround to avoid a warning
	by gcc about the use of "%c" in the format string.
2004-08-28 18:56:46 +00:00
Sven Neumann 907a276066 libgimpwidgets/libgimpwidgets-sections.txt added
2004-08-28  Sven Neumann  <sven@gimp.org>

        * libgimpwidgets/libgimpwidgets-sections.txt
        * libgimpwidgets/tmpl/gimpwidgets.sgml:
        added gimp_scale_entry_[get|set]_logarithmic().
2004-08-28 18:15:34 +00:00
Sven Neumann 7e9f0d4a71 applied a patch from Joao S. O. Bueno which adds an API that allows to
2004-08-28  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
	S. O. Bueno which adds an API that allows to make the scale widget
	of a GimpScaleEntry behave logarithmic. Fixes bug #149420.

	* app/widgets/gimpbrusheditor.c: use the new functionality for the
	radius control.
2004-08-28 16:57:37 +00:00
Sven Neumann 32b019ffa9 applied patch from Markus Triska that improves which layers are choosen by
2004-08-28  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/compose.c (compose_dialog): applied patch from
	Markus Triska that improves which layers are choosen by
	default (bug #148172).
2004-08-28 12:10:48 +00:00
Sven Neumann 804788c120 applied a patch from Eric Cheung that changes the function to use a GQueue
2004-08-28  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-contiguous-region.c
	(find_contiguous_region_helper): applied a patch from Eric Cheung
	that changes the function to use a GQueue to implement recursion
	instead of recursive function calls. Fixes bug #151124.

	* plug-ins/common/noisify.c (noisify_dialog): left-align the
	preview.
2004-08-28 11:48:00 +00:00
Sven Neumann 52bf83ee69 app/widgets/gimphelp-ids.h added a help-id for the image area.
2004-08-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h
	* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
	help-id for the image area.
2004-08-28 10:57:24 +00:00
Sven Neumann e3ac5708aa merged fixes from stable branch.
2004-08-27  Sven Neumann  <sven@gimp.org>

	* de.po: merged fixes from stable branch.
2004-08-27 20:53:12 +00:00
Michael Natterer 50ee45d79a added missing file. 2004-08-27 20:20:35 +00:00
Michael Natterer d7f73e6f8a Moved the gimp_progress_init() and gimp_progress_update() PDB functions to
2004-08-27  Michael Natterer  <mitch@gimp.org>

	Moved the gimp_progress_init() and gimp_progress_update() PDB
	functions to their own group because they don't belong to the
	"Plug-In" namespace and will soon get more functions.

	* tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff...

	* tools/pdbgen/pdb/progress.pdb: ...and added it here.

	* tools/pdbgen/Makefile.am
	* tools/pdbgen/groups.pl
	* app/pdb/Makefile.am
	* libgimp/Makefile.am: changed accordingly.

	* libgimp/gimpprogress_pdb.[ch]: new generated files.

	* app/pdb/internal_procs.c
	* app/pdb/plug_in_cmds.c
	* libgimp/gimp_pdb.h
	* libgimp/gimpplugin_pdb.[ch]: regenerated.
2004-08-27 20:06:17 +00:00
Michael Natterer 28e1f2a9da call gimp_container_editor_select_item() manually at construction time so
2004-08-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainereditor.c
	(gimp_container_editor_construct): call
	gimp_container_editor_select_item() manually at construction time
	so views show the initially selected object's state correctly
	(e.g. the brush spacing). Fixes bug #151227.
2004-08-27 17:38:57 +00:00
David Odin ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
Sven Neumann c27a5a30a6 fixed Wiki syntax in output.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* fortunes.xsl: fixed Wiki syntax in output.
2004-08-26 19:43:51 +00:00
Sven Neumann 10dd89960c Makefile.am added simple XSL transformation to generate fortunes for
2004-08-26  Sven Neumann  <sven@gimp.org>

	* Makefile.am
	* fortunes.xsl: added simple XSL transformation to generate
	fortunes for wiki.gimp.org from gimp-tips.xml.in.
2004-08-26 18:15:10 +00:00
Michael Natterer f1d0db6d99 removed "gboolean use_default_values" from GimpItem::stroke().
2004-08-26  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: removed "gboolean use_default_values"
	from GimpItem::stroke().

	* app/core/gimpchannel.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: changed accordingly.
2004-08-26 16:33:42 +00:00
Michael Natterer 23bd12162d implement the whole paint_options fiddling here instead of in each
2004-08-26  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.c (gimp_item_stroke): implement the whole
	paint_options fiddling here instead of in each subclass and pass
	either GimpStrokeOptions or GimpPaintOptions (instead of
	GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke().

	Also copied code (that needs to be abstracted to a utility
	function) from the tool_manager which makes sure we really use the
	global brush, pattern etc. if these options are checked in prefs.
	Fixes bug #150716.

	* app/core/gimpchannel.c (gimp_channel_stroke)
	* app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the
	duplicated code mentioned above and simply use the paint_options
	passed.
2004-08-26 16:06:13 +00:00
Michael Natterer e919974b52 app/app-docs.sgml app/app-sections.txt updated.
2004-08-26  Michael Natterer  <mitch@gimp.org>

	* app/app-docs.sgml
	* app/app-sections.txt
	* app/app.types: updated.
2004-08-26 15:20:09 +00:00
David Odin 5af63086ba GimpViewRendererVector is really derived from GimpViewRenderer and not
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
  really derived from GimpViewRenderer and not from GimpViewRendererDrawable.
2004-08-26 14:59:31 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
Sven Neumann db6dff283f try to convert the result of gimp_directory() to UTF-8 and bail out with a
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/sanity.c (sanity_check_filename_encoding): try to convert
	the result of gimp_directory() to UTF-8 and bail out with a
	moderately helpful error message if this conversion fails. Works
	around bug #150917. Also marked these strings for translation.
2004-08-26 09:48:32 +00:00
Sven Neumann 7e18e1f3f8 set the paintbrush as the default tool as suggested in bug #151091.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
	as the default tool as suggested in bug #151091.
2004-08-26 09:41:18 +00:00
Sven Neumann b80d513c1d minor update.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* de.po: minor update.
2004-08-26 08:18:30 +00:00
David Odin d93b26e7fa app/widgets/gimppreview-popup.c app/widgets/gimppreview-popup.h
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
2004-08-26 00:50:45 +00:00
Manish Singh b6d3a912fd Guard against bogus logical screen dimensions. Fixes bug #151053.
2004-08-25  Manish Singh  <yosh@gimp.org>

        * plug-ins/common/gifload.c: Guard against bogus logical screen
        dimensions. Fixes bug #151053.
2004-08-25 22:32:54 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann e6a034fc2d app/app-docs.sgml app/app-sections.txt updated.
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/app-docs.sgml
	* app/app-sections.txt
	* app/app.types: updated.
2004-08-25 20:22:53 +00:00
Sven Neumann 8b6970ec28 stop adding message boxes and redirect messages to stderr if there are too
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
	adding message boxes and redirect messages to stderr if there are
	too many messages.
2004-08-25 19:49:50 +00:00
William Skaggs c92a38626b Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
2004-08-25 18:26:06 +00:00
Sven Neumann da66a8db22 updated.
2004-08-25  Sven Neumann  <sven@gimp.org>

	* POTFILES.in: updated.
2004-08-25 18:02:07 +00:00
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
David Odin 54fa5a0af9 eradicate some more previews in favor of views.
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
  in favor of views.
2004-08-25 17:54:12 +00:00
William Skaggs 856b87b105 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/Makefile.am: added ggr.txt to list.
2004-08-25 17:50:35 +00:00
William Skaggs 21ba16c67d Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: added new file decribing the ggr
	(Gimp gradient) file format.
2004-08-25 17:41:34 +00:00
David Odin f168881c18 app/display/gimpnavigationview.c renamed these files to...
* app/display/gimpnavigationview.c
* app/display/gimpnavigationview.h: renamed these files to...

* app/display/gimpnavigationeditor.c
* app/display/gimpnavigationeditor.h: ... these files, and of course
  changed GimpNavigationView to GimpNavigationEditor since it is really
  inherited from GimpEditor anyway.

This will leave the gimp_navigation_view namespace for the renaming
from gimp_navigation_preview.

* app/display/Makefile.am
* app/display/display-types.h
* app/display/gimpdisplayshell-callbacks.c
* app/gui/dialogs-constructors.c: Changed accordlingly.
2004-08-25 16:02:10 +00:00
Michael Natterer da34232a04 print bad '%' sequences literally instead of warning (g_warning() is for
2004-08-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): print bad '%' sequences
	literally instead of warning (g_warning() is for programming
	errors only and must never be triggered by bad or intermediate
	user input). Fixes bug #150676
2004-08-25 14:38:49 +00:00
Sven Neumann d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00