Commit Graph

56 Commits

Author SHA1 Message Date
Sven Neumann e09c3f2da6 app/dialogs/vectors-import-dialog.c (vectors_import_dialog_new) fixed
2006-03-03  Sven Neumann  <sven@gimp.org>

	* app/dialogs/vectors-import-dialog.c (vectors_import_dialog_new)
	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	fixed capitalization of filter names.
2006-03-03 22:46:01 +00:00
Michael Natterer e397c0ef0a set the new "do-overwrite-confirmation" property on GtkFileChooser.
2005-12-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]: set the new
	"do-overwrite-confirmation" property on GtkFileChooser. Removed
	gimp_file_overwrite_dialog().

	* app/dialogs/file-save-dialog.c (file_save_dialog_check_uri):
	removed broken code which tried to figure if a file exists.
	Fixes bug #309729.

	* app/widgets/gimpdnd-xds.c: added gimp_file_overwrite_dialog()
	here as private utility function.
2005-12-28 20:02:54 +00:00
Michael Natterer 61df53ec54 port to G_DEFINE_TYPE() and friends. Some related cleanup.
2005-12-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/*.c: port to G_DEFINE_TYPE() and friends. Some
	related cleanup.
2005-12-19 22:37:49 +00:00
Sven Neumann ee64ca3c90 introduced variants of file_utils_uri_to_utf8_filename() and
2005-10-02  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: introduced variants of
	file_utils_uri_to_utf8_filename() and
	file_utils_uri_to_utf8_basename() that use g_filename_display_name()
	and g_filename_display_basename().

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-actions.c
	* app/actions/file-commands.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-title.c
	* app/file/file-open.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.c: use the new functions.

	* plug-ins/help/domain.c: use g_filename_display_name().
2005-10-01 22:43:22 +00:00
Michael Natterer 14b9312a72 app/widgets/gimpprogressbox.c made progress bars HIG compliant (with
2005-09-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpprogressbox.c
	* plug-ins/script-fu/script-fu-interface.c: made progress bars HIG
	compliant (with italic label below).

	* app/widgets/gimpfiledialog.[ch]: use a GimpProgressBox intead of
	implementing the progress bar again.
2005-09-28 21:20:05 +00:00
Michael Natterer b10adabb5e Added parent window API to the GimpProgress interface and to the libgimp
2005-09-09  Michael Natterer  <mitch@gimp.org>

	Added parent window API to the GimpProgress interface and to
	the libgimp progress stuff. Might look strange, but does
	the right thing in almost all cases (image window, file dialog,
	script-fu dialog etc). Fixes bug #62988.

	* app/core/gimpprogress.[ch]: added GimpProgress::get_window()
	which should return a toplevel window ID if the progress is in a
	window that wants to be the transient parent of plug-in dialogs.

	* app/widgets/gimpwidgets-utils.[ch] (gimp_window_get_native): new
	function which returns the window handle of a GtkWindow's GdkWindow.

	* app/widgets/gimpfiledialog.c: implement ::get_window().

	* app/display/gimpdisplay.[ch]: ditto. Removed window handle API.

	* app/gui/gui-vtable.c: changed accordingly.

	* libgimpbase/gimpbaseenums.[ch] (enum GimpProgressCommand):
	added GIMP_PROGRESS_COMMAND_GET_WINDOW.

	* app/plug-in/plug-in-progress.[ch] (plug_in_progress_get_window):
	new function. Also renamed some functions to match the
	GimpProgress interface, and not the legacy PDB procedure names.

	* tools/pdbgen/pdb/progress.pdb
	* app/core/gimppdbprogress.c: implement get_window() on both
	sides of the wire, keeping backward compatibility (hopefully).

	* libgimp/gimpprogress.[ch]: deprecated gimp_progress_install()
	and added gimp_progress_install_vtable() which takes a vtable with
	padding to be extensible. Added get_window() vtable entry and
	dispatch it accordingly. Also added pulse() which was implemented
	in a hackish way before. Everything is of course backward
	compatible.

	* libgimp/gimpprogressbar.c: inmplement the get_window() stuff
	so a plug-in dialog containing a progress can be the transient
	parent of another dialog in another plug-in.

	* libgimp/gimpui.[ch] (gimp_ui_get_progress_window): new function
	which returns a foreign GdkWindow of this plug-ins progress
	window.

	Renamed gimp_window_set_transient_for_default_display() to
	gimp_window_set_transient() and make it use the progress' window
	handle instead of the display's (which is the right thing to do in
	almost all cases).

	* libgimp/gimp.def
	* libgimp/gimpui.def: add the new functions.

	* tools/pdbgen/enums.pl
	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimpexport.c
	* plug-ins/*/*.c: follow API change.
2005-09-09 18:07:31 +00:00
Sven Neumann e7a14aaa71 applied capitalization patches contributed by Stephan Binner. Fixes bug
2005-08-23  Sven Neumann  <sven@gimp.org>

	* [lots of files]: applied capitalization patches contributed by
	Stephan Binner. Fixes bug #309657.
2005-08-23 00:18:08 +00:00
Sven Neumann 2cbf6ca5f4 when looking for the file extension, only look at the part after the last
2005-08-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	when looking for the file extension, only look at the part after
	the last directory separator.
2005-08-20 20:34:25 +00:00
Michael Natterer 4e9fd4f69f canonicalize hardcoded procedure names.
2005-08-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new):
	canonicalize hardcoded procedure names.
2005-08-03 09:38:01 +00:00
Michael Natterer c6ca1a8419 enable remote files: set local_only to FALSE if the PDB has
2005-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): enable
	remote files: set local_only to FALSE if the PDB has
	"file_uri_load/save" procedures (yes, this is questionable).
2005-07-08 18:27:24 +00:00
Sven Neumann f6cb341c3c app/dialogs/file-save-dialog.c moved overwrite confirmation dialog to
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/dialogs/file-save-dialog.c
	* app/widgets/gimpfiledialog.[ch]: moved overwrite confirmation
	dialog to app/widgets.

	* app/widgets/gimpdnd-xds.c: set "Untitled.xcf" as default name
	for untitled images; ask for confirmation before overwriting a
	local file.
2005-03-25 20:18:55 +00:00
Sven Neumann 7c19953c39 added GimpProgress::pulse.
2005-02-12  Sven Neumann  <sven@gimp.org>

	* app/core/gimpprogress.[ch]: added GimpProgress::pulse.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it in the classes that
	implement the GimpProgress interface.

	* app/plug-in/plug-in-progress.[ch]: allow plug-ins to pulse their
	progress.

	* tools/pdbgen/pdb/progress.pdb: added a procedure for the new
	functionality.

	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-02-12 14:18:12 +00:00
Sven Neumann d4535cc31f add an "All Images" filter and select it by default.
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): add
	an "All Images" filter and select it by default.
2005-02-07 18:46:03 +00:00
Sven Neumann 747ffe8b6e ooops, didn't mean to commit that change 2005-02-07 17:31:40 +00:00
Sven Neumann 313f7835cb changed "Remote Image" to "Remote File". The state of the thumbnail
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c (gimp_imagefile_get_desc_string):
	changed "Remote Image" to "Remote File". The state of the
	thumbnail doesn't tell us if this is an image file at all.

	* app/widgets/gimpthumbbox.c: don't auto-thumbnail remote files.

	* libgimpthumb/gimpthumb-utils.[ch]
	* libgimpthumb/gimpthumbnail.c: do the same workaround for UNC
	paths as in file_utils_filename_from_uri().
2005-02-07 17:29:10 +00:00
Michael Natterer 4f97f7a5f9 Made the file open and save dialogs use the last used folder instead of
2005-01-13  Michael Natterer  <mitch@gimp.org>

	Made the file open and save dialogs use the last used folder
	instead of defaulting to current directory. Fixes bug #162385.

	* app/widgets/gimpfiledialog.[ch] (gimp_file_dialog_set_uri):
	removed this function because it had no functionality except
	creating usability problems.

	* app/actions/file-commands.c: use gtk_file_chooser_set_uri()
	instead but *only* if we already have an uri from an alread open
	image or the document hinstory.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): set
	the file chooser's uri only if we have an uri from the image
	itself. Leave the current folder untouched otherwise and just set
	the current name (e.g. "Untitled").

	* app/dialogs/file-save-dialog.c (file_save_dialog_save_image): on
	successful save, remember the used uri by attaching it to the
	"gimp" instance.

	(file_save_dialog_new): set the last saved uri's folder on the
	newly created file save dialog.
2005-01-13 17:41:48 +00:00
Michael Natterer 30164f1be2 added back the .xcf.gz and .xcf.bz2 extensions because they are the only
2004-11-18  Michael Natterer  <mitch@gimp.org>

	* plug-ins/common/compressor.c (compressors): added back the
	.xcf.gz and .xcf.bz2 extensions because they are the only way
	to figure the special nature of this plug-in's extensions.

	* app/widgets/gimpfileprocview.[ch]: keep a list of "meta
	extensions" (extensions which have a '.' themselves).

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	try to replace the whole extension if the last extension is one of
	the meta extensions kept by GimpFileProcView. Fixes bug #158377.
2004-11-18 11:50:25 +00:00
Sven Neumann d4bf381c20 app/actions/file-commands.c app/dialogs/file-save-dialog.c
2004-11-16  Sven Neumann  <sven@gimp.org>

	* app/actions/file-commands.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-save.[ch]
	* app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
	"set_image_clean" parameters into a single "save_a_copy"
	parameter.  When saving a copy, attach the used URI to the image and
	let the "Save a Copy" file chooser default to the last used value.
2004-11-16 13:37:36 +00:00
Sven Neumann c286aece5d limit the number of file extensions that are added to the file filter menu
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	limit the number of file extensions that are added to the file
	filter menu to keep the file dialog from growing too wide.
2004-11-15 19:33:24 +00:00
Sven Neumann 562b1595f2 better fix for bug #158369.
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	better fix for bug #158369.
2004-11-15 13:42:22 +00:00
Sven Neumann e196a77246 return early if gimp_file_proc_view_get_proc() didn't return a file
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	return early if gimp_file_proc_view_get_proc() didn't return a file
	procedure. Should fix bug #158369.
2004-11-15 13:38:00 +00:00
Sven Neumann c70b12137b plugged a mem-leak.
2004-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	plugged a mem-leak.

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_render): don't leak the pixbuf.

	* app/widgets/gimpviewrenderer-frame.c: added a comment.
2004-11-03 00:48:06 +00:00
Sven Neumann caac418cb2 don't check for file_proc->menu_paths. Our load and save procedure don't
2004-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	don't check for file_proc->menu_paths. Our load and save procedure
	don't necessarily register a menu path any longer.

	* app/plug-in/plug-ins.c: minor cleanup.

	* app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
	XCF load and save procedures.

	* tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.

	* app/pdb/fileops_cmds.c
	* libgimp/gimpfileops_pdb.c: regenerated.
2004-11-01 15:44:57 +00:00
Sven Neumann 5460383b57 construct a case-insensitive glob pattern to use when filtering for file
2004-10-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: construct a case-insensitive glob
	pattern to use when filtering for file extensions.
2004-10-11 11:57:32 +00:00
Sven Neumann 94b427de98 added a help button.
2004-10-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: added a help button.
2004-10-04 22:25:04 +00:00
Michael Natterer 9ffc00be80 app/plug-in/Makefile.am removed... ...and added with a new name.
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-proc.[ch]: removed...
	* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.

	* app/plug-in/plug-in-def.[ch]
	* app/plug-in/plug-in-message.[ch]
	* app/plug-in/plug-in-progress.[ch]
	* app/plug-in/plug-in-rc.[ch]
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.[ch]
	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
	minor cosmetic cleanups.

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2004-09-22 15:12:24 +00:00
Michael Natterer d8a3c0c08c simplified the code that selects an image file by its URI.
2004-09-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
	simplified the code that selects an image file by its URI.
2004-09-07 10:45:36 +00:00
Sven Neumann 4bfbd2c5c3 bumped version number to 2.1.5.
2004-09-05  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped version number to 2.1.5.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
	the image file, not only the folder it lives in. Fixes bug #151638.
2004-09-05 20:17:53 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann 509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
Michael Natterer 57a3396d40 added virtual function gboolean GimpProgressInterface::is_active().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpprogress.[ch]: added virtual function
	gboolean GimpProgressInterface::is_active().

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it.

	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
	added "gulong progress_cancel_id" instead.

	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
	we correctly handle the "cancel" connections of progress instances
	passed from other plug-ins.
2004-08-11 10:29:56 +00:00
Michael Natterer 06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
Michael Natterer 95607cce19 new function which works on all widgets in the dialog except the cancel
2004-08-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]
	(gimp_file_dialog_set_sensitive): new function which works on all
	widgets in the dialog except the cancel button.

	Remember if the active progress is cancelable and added two
	booleans "busy" and "canceled". Added GtkDialog::response()
	implementation which, if the dialog is busy, cancels the active
	progress and sets the dialog's "canceled" state.

	Moved the progress bar right above the action area so it is next
	to the cancel button and in the same place for both open and save
	dialogs.

	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: use the new API to make image loading
	and saving cancelable again.

	* app/widgets/gimpthumbbox.c: use the same stuff to make
	thumbnailing cancelable. Increased the minimum height a bit so it
	doesn't resize when the progress bars are shown.
2004-08-10 21:20:38 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Sven Neumann 7e3e851c63 string change.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
2004-07-27 12:41:44 +00:00
Michael Natterer a66a3b47c9 make sure we always set a non-null URI.
2004-07-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
	sure we always set a non-null URI.
2004-07-27 12:39:56 +00:00
Sven Neumann a1ac37ed19 show extensions in the filters menu.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	show extensions in the filters menu.
2004-07-27 00:26:14 +00:00
Michael Natterer 09c6ee7363 added the removed help IDs back.
2004-07-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: added the removed help IDs back.

	* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
	IDs and added gimp_file_proc_view_get_help_id() which returns the
	selected item's help ID.

	* app/widgets/gimpfiledialog.c: added a custom help func which
	shows the help for the selected file_proc if the proc_view has the
	focus.
2004-07-17 19:53:05 +00:00
Sven Neumann d95059db48 use GIMP_STOCK_WEB for "file-open-location".
2004-07-17  Sven Neumann  <sven@gimp.org>

	* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
	for "file-open-location".

	* app/widgets/gimpfiledialog.c: create the scrolled window with
	shadow_type GTK_SHADOW_IN.

	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
	procedures that register a prefix (the URL loader).

	* app/widgets/gimphelp-ids.h: removed help IDs that used to be
	used from the file-open and file-save menus.

	* plug-ins/common/xwd.c (query): "X window dump" seems to be more
	appropriate than "X window image".
2004-07-17 13:06:59 +00:00
Sven Neumann ccf8ed69e7 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget that
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfileprocview.[ch]: added new widget that offers
	a treeview on file procedures.

	* app/widgets/gimpfiledialog.[ch]: replaced the file type option
	menu with the new GimpFileProcView widget.
	(gimp_file_dialog_set_image): reset the file type to Automatic
	(fixes bug #141535).

	* app/actions/file-commands.c
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.[ch]: changed accordingly.

	* plug-ins/common/bz2.c
	* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
	extension. It's redundant and breaks the code that sets the
	extension from the selected file-type.

	* plug-ins/common/dicom.c: register a shorter menu label.

	* plug-ins/common/gbr.c
	* plug-ins/common/gih.c
	* plug-ins/common/pat.c
	* plug-ins/common/url.c: register stock icons.
2004-07-16 21:24:39 +00:00
Sven Neumann a5fcdf28c7 unset the filename if the image is unnamed.
2004-06-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if the image is unnamed.

	* configure.in
	* app/sanity.c: depend on gtk+ >= 2.4.1.

	* app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris()
	to gimp_thumb_box_take_uris() since the function takes ownership
	of the list,

	* app/widgets/gimpfiledialog.c: changed accordingly. Removed code
	that worked around a problem in gtk+ < 2.4.1.
2004-06-22 15:11:35 +00:00
Sven Neumann 62b59db976 app/display/gimpdisplayshell-scale.c app/gui/info-window.c
2004-06-02  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c
	* app/gui/info-window.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
	consistency and better HIG compliance.
2004-06-02 17:56:02 +00:00
Michael Natterer ca179a7757 Changed plug-in menu registration again to allow passing just the menu
2004-05-07  Michael Natterer  <mitch@gimp.org>

	Changed plug-in menu registration again to allow passing just the
	menu item's label (not the full path) in gimp_install_procedure()
	and only the path (excluding the item's label) in
	gimp_plugin_menu_register(). Matches the internal action system
	better and makes translating the menu paths much easier.

	(Of yourse it's still possible to use the old syntax for backward
	compatibility).

	* app/plug-in/plug-in-proc.[ch]: added "gchar *menu_label".

	* app/plug-in/plug-in-params.[ch]: added new functions
	plug_in_param_defs_check() and plug_in_proc_args_check() which
	check if a procedure's parameters match its menu location
	(e.g. <Image> needs RUN-MODE, IMAGE, DRAWABLE).

	* app/plug-in/plug-in-message.c (plug_in_handle_proc_install): if
	registering an old-style (full) menu_path, use
	plug_in_param_defs_check(), set proc_def->menu_label otherwise.

	* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): use
	plug_in_proc_args_check() on the passed menu_path and make sugre
	old and new style menu registration are not mixed.

	* app/pdb/plug_in_cmds.c: regenerated.

	* app/plug-in/plug-in-rc.c: save/restore "menu_label".

	* app/actions/file-dialog-actions.c
	* app/actions/plug-in-actions.c
	* app/menus/plug-in-menus.c: changed action/menu creation
	accordingly. Some hacks needed to allow both old and new style
	menu_label/menu_paths.

	* app/plug-in/plug-in.c
	* app/widgets/gimpfiledialog.c
	* app/xcf/xcf.c: changed accordingly.

	* plug-ins/common/align_layers.c
	* plug-ins/common/animationplay.c
	* plug-ins/common/animoptimize.c
	* plug-ins/common/apply_lens.c
	* plug-ins/common/autocrop.c
	* plug-ins/common/autostretch_hsv.c
	* plug-ins/common/blinds.c
	* plug-ins/common/blur.c
	* plug-ins/common/borderaverage.c
	* plug-ins/common/bumpmap.c
	* plug-ins/common/c_astretch.c
	* plug-ins/common/ccanalyze.c
	* plug-ins/common/channel_mixer.c
	* plug-ins/common/checkerboard.c
	* plug-ins/common/color_enhance.c
	* plug-ins/common/colorify.c
	* plug-ins/common/colortoalpha.c
	* plug-ins/common/compose.c
	* plug-ins/common/convmatrix.c
	* plug-ins/common/cubism.c
	* plug-ins/common/curve_bend.c
	* plug-ins/common/decompose.c
	* plug-ins/common/deinterlace.c
	* plug-ins/common/depthmerge.c
	* plug-ins/common/destripe.c
	* plug-ins/common/diffraction.c
	* plug-ins/common/displace.c
	* plug-ins/common/edge.c
	* plug-ins/common/emboss.c
	* plug-ins/common/engrave.c
	* plug-ins/common/exchange.c
	* plug-ins/common/film.c
	* plug-ins/common/flarefx.c
	* plug-ins/common/fractaltrace.c
	* plug-ins/common/screenshot.c: ported the first few plug-ins
	to the new registration scheme.
2004-05-07 00:30:24 +00:00
Michael Natterer 7b943b64b0 Enabled multiple menu entries per plug-in procedure:
2004-05-06  Michael Natterer  <mitch@gimp.org>

	Enabled multiple menu entries per plug-in procedure:

	* app/plug-in/plug-in-proc.[ch]: changed "gchar *menu_path" to
	"GList *menu_paths".

	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins.c
	* app/menus/menus.c
	* app/widgets/gimpfiledialog.c
	* app/xcf/xcf.c: changed accordingly.

	* app/actions/file-dialog-actions.c
	* app/actions/plug-in-actions.c: create an action for the first
	element of proc_def->menu_paths.

	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.[ch]: create proxy widgets for each
	element of proc_def->menu_paths.

	* tools/pdbgen/pdb/plug_in.pdb: added new function
	gimp_plugin_menu_add() which can be called during query() and adds
	a menu path to a procedure registered by the calling plugin.

	* app/pdb/internal_procs.c
	* app/pdb/plug_in_cmds.c
	* libgimp/gimpplugin_pdb.[ch]: regenerated.

	* menus/image-menu.xml.in
	* menus/toolbox-menu.xml.in: added lots of <placeholder>s for
	logical groups (like Image/Resize, Image/Scale, Image/Crop
	etc.). Added empty placeholder File/Send for stuff like print and
	mail. Added an "Acquire" menu under <Image>/File

	* plug-ins/common/mail.c
	* plug-ins/print/print.c
	* plug-ins/common/winprint.c: register under File/Send.

	* plug-ins/common/screenshot.c
	* plug-ins/winsnap/winsnap.c: also register under
	<Image>/File/Acquire.

	* plug-ins/common/autocrop.c
	* plug-ins/common/ccanalyze.c
	* plug-ins/common/colortoalpha.c
	* plug-ins/common/threshold_alpha.c
	* plug-ins/common/zealouscrop.c: register additional menu entries
	under placeholders in the "Image" and "Layer" menus. This is not
	meant to be final but just a hint to keep in mind when
	reorganizing the plug-in menus.
2004-05-06 13:51:56 +00:00
Michael Natterer 90438eaaae removed debugging output, added #warning about runtime version check that
2004-05-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c: removed debugging output, added
	#warning about runtime version check that can be removed as soon
	as we depend on GTK+ 2.4.1.
2004-05-04 15:09:53 +00:00
Michael Natterer 0e1af3ee5a app/actions/Makefile.am app/actions/file-open-actions.[ch] actions for the
2004-04-29  Michael Natterer  <mitch@gimp.org>

	* app/actions/Makefile.am
	* app/actions/file-open-actions.[ch]
	* app/actions/file-save-actions.[ch]: actions for the <Load> and
	<Save> menus...

	* menus/Makefile.am
	* menus/file-open-menu.xml
	* menus/file-save-menu.xml: ...and the menus.

	* app/gui/file-open-menu.[ch]
	* app/gui/file-save-menu.[ch]: ported to UI Manager.

	* app/widgets/gimpfiledialog.[ch]: ditto.

	* app/actions/actions.c
	* app/gui/menus.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: changed accordingly.

	* app/widgets/gimpuimanager.c: removed debugging code which
	automatically loaded all registered menus. They are now loaded on
2004-04-29 17:47:53 +00:00
Michael Natterer 25589863a3 app/display/gimpdisplayshell-callbacks.c app/display/gimpdisplayshell.c
2004-04-15  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.c
	* app/widgets/gimpcontainertreeview.c: removed runtime version
	checks and workarounds for bugs which are fixed in GTK+ 2.4.

	* app/widgets/gimpfiledialog.c
	(gimp_file_dialog_selection_changed): added runtime check for GTK+
	2.4.1 and work around GtkFileChooser's missing "update_preview"
	functionality for multiple selections if the dependency is not
	met.

	* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
	(gimp_menu_button_position): call gtk_menu_set_monitor() until
	bug #139187 is fixed.
2004-04-15 16:54:44 +00:00
Michael Natterer 2f2301c905 derive it from GtkFileChooser instead of GtkFileSelection.
2004-04-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser
	instead of GtkFileSelection.

	* app/gui/file-dialog-utils.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimpthumbbox.c: changed accordingly.

	* app/gui/gradients-commands.c
	* app/gui/vectors-commands.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimptexteditor.c
	* libgimpwidgets/gimpfileentry.c: use file choosers instead of
	file selectors.
2004-04-15 16:28:26 +00:00
Michael Natterer 999a4f7a91 eek, the separator crept back in while hacking GimpFileDialog. Removed it
2004-03-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_init): eek, the
	separator crept back in while hacking GimpFileDialog. Removed it
	again.
2004-03-04 13:48:35 +00:00