dnrops
/
gimp
mirror of https://github.com/GNOME/gimp.git
1
0
Fork 0
Code Issues Packages Projects Releases Wiki Activity
gimp/app/widgets/Makefile.am

308 lines
7.3 KiB
Makefile
Raw Normal View History

Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
## Process this file with automake to produce Makefile.in
app/base/Makefile.am automake-1.6 seems to use yet another variable to 2002-06-08 Sven Neumann <sven@gimp.org> * app/base/Makefile.am * app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another variable to pass flags to the assembler (bug #84514). Define AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake. * configure.in * all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a GNU make extension that we don't really need and newer versions of automake don't seem to like it.
2002-06-08 07:00:46 +08:00
AM_CPPFLAGS = \
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
-DG_LOG_DOMAIN=\"Gimp-Widgets\" \
@GIMP_THREAD_FLAGS@ \
app/base/Makefile.am automake-1.6 seems to use yet another variable to 2002-06-08 Sven Neumann <sven@gimp.org> * app/base/Makefile.am * app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another variable to pass flags to the assembler (bug #84514). Define AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake. * configure.in * all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a GNU make extension that we don't really need and newer versions of automake don't seem to like it.
2002-06-08 07:00:46 +08:00
@GIMP_MP_FLAGS@
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
app/base/Makefile.am automake-1.6 seems to use yet another variable to 2002-06-08 Sven Neumann <sven@gimp.org> * app/base/Makefile.am * app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another variable to pass flags to the assembler (bug #84514). Define AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake. * configure.in * all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a GNU make extension that we don't really need and newer versions of automake don't seem to like it.
2002-06-08 07:00:46 +08:00
INCLUDES = \
-I$(top_builddir) \
-I$(top_srcdir) \
-I$(top_builddir)/app \
-I$(top_srcdir)/app \
$(GTK_CFLAGS) \
$(PANGOFT2_CFLAGS) \
-I$(includedir)
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
app/Makefile.am app/base/Makefile.am app/core/Makefile.am 2001-06-05 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/base/Makefile.am * app/core/Makefile.am * app/gui/Makefile.am * app/paint-funcs/Makefile.am * app/pdb/Makefile.am * app/tools/Makefile.am * app/widgets/Makefile.am: no need to build .la objects for convenience libraries which are never linked into another dynamic library. Create simple .a files instead. Reduces compilation time of app/ by about 50%.
2001-06-06 00:14:47 +08:00
noinst_LIBRARIES = libappwidgets.a
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
app/base/Makefile.am automake-1.6 seems to use yet another variable to 2002-06-08 Sven Neumann <sven@gimp.org> * app/base/Makefile.am * app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another variable to pass flags to the assembler (bug #84514). Define AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake. * configure.in * all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a GNU make extension that we don't really need and newer versions of automake don't seem to like it.
2002-06-08 07:00:46 +08:00
libappwidgets_a_sources = \
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
widgets-enums.h \
app/Makefile.am removed. 2001-05-25 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimpui.[ch]: removed. * app/tools/paint_options.[ch]: removed paint_mode_menu_new(). * app/widgets/Makefile.am * app/widgets/gimpwidgets-constructors.[ch] * app/widgets/gimpwidgets-utils.[ch]: added here. * app/disp_callbacks.c * app/errors.c * app/gimphelp.c * app/interface.c * app/gui/brush-select.c * app/gui/channels-commands.c * app/gui/commands.c * app/gui/file-dialog-utils.c * app/gui/file-open-dialog.c * app/gui/file-save-dialog.c * app/gui/layers-commands.c * app/gui/tool-options-dialog.c * app/tools/gimpbrightnesscontrasttool.c * app/tools/gimpbycolorselecttool.c * app/tools/gimpclonetool.c * app/tools/gimpcolorbalancetool.c * app/tools/gimpcolorpickertool.c * app/tools/gimpcurvestool.c * app/tools/gimphistogramtool.c * app/tools/gimphuesaturationtool.c * app/tools/gimplevelstool.c * app/tools/gimpposterizetool.c * app/tools/gimpsmudgetool.c * app/tools/gimptexttool.c * app/tools/gimpthresholdtool.c * app/tools/gimptransformtool.c * app/tools/tool_manager.c * app/widgets/gimplayerlistview.c: changed accordingly.
2001-05-26 00:04:54 +08:00
widgets-types.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new GtkAction subclass 2004-05-19 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpaction.[ch]: new GtkAction subclass which can show either a color or viewable preview in GtkImageMenuItem proxies. * app/widgets/gimpenumaction.[ch] * app/widgets/gimppluginaction.[ch] * app/widgets/gimpstringaction.[ch]: derive them from GimpAction. * app/widgets/gimpactiongroup.c (gimp_action_group_add_actions): add GimpActions, not GtkActions. (gimp_action_group_set_action_color) (gimp_action_group_set_action_viewable): removed all hacks and simply set the "color" or "viewable" properties of the GimpAction to change. Fixes color/viewable previews in menus. * app/actions/file-actions.c: show previews in the "Open Recent" menu items. Unrelated: * app/widgets/widgets-types.h: removed GimpDockedInterface typedef... * app/widgets/gimpdocked.h: ...and added it here. We don't have class struct typedefs in the types header either. * app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut for "edit-fill-pattern". * app/actions/gradient-editor-actions.c: added some stock IDs. Please comment.
2004-05-20 04:56:37 +08:00
gimpaction.c \
gimpaction.h \
More unused action stuff: 2004-04-21 Michael Natterer <mitch@gimp.org> More unused action stuff: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpactionfactory.[ch]: added a simple factory which produces GimpActionGroups. * app/widgets/gimpactiongroup.[ch]: added an "update_func" member to the GimpActionGroup struct. Added it as parameter to gimp_action_group_new(). Added function gimp_action_group_update(). * app/widgets/gimpmenufactory.[ch]: added an "action_factory" member and constructor parameter. Added code to create GtkUIManagers from registered action group identifiers. * app/actions/Makefile.am * app/actions/actions.[ch]: new files: create a "global_action_factory" and register all action groups with it. * app/actions/edit-actions.c: s/edit_action_update/edit_actions_update/ * app/actions/plug-in-actions.[ch]: added API to add/remove plug-in procedure actions dynamically (unfinished). * app/gui/menus.c (menus_init): call actions_init(). (menus_exit): call actions_exit().
2004-04-21 07:04:50 +08:00
gimpactionfactory.c \
gimpactionfactory.h \
new marshaller VOID:STRING 2004-04-16 Michael Natterer <mitch@gimp.org> * app/core/gimpmarshal.list: new marshaller VOID:STRING * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpactiongroup.[ch] * app/widgets/gimpenumaction.[ch] * app/widgets/gimpstringaction.[ch]: added some completely unused GtkAction infrastructure.
2004-04-16 20:09:46 +08:00
gimpactiongroup.c \
gimpactiongroup.h \
app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties 2004-07-20 Michael Natterer <mitch@gimp.org> * app/widgets/gimpactionfactory.[ch] * app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id" properties to GtkActionGroup and allow to register them in the GimpActionFactory. * app/actions/actions.c: register user visible labels and icons with all action groups. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpactionview.[ch]: new widget which shows a treeview of action groups and their actions & shortcuts. * app/widgets/gimpaction.[ch]: added gimp_action_name_compare() utility function. * app/widgets/gimpwidgets-utils.[ch]: added gimp_get_accel_string() utility function. * app/widgets/gimpcontrollers.[ch]: added gimp_controllers_get_ui_manager() which will be used for setting up the controller mapping dialog. * app/gui/preferences-dialog.c: added a "Configure Keyboard Shortcuts" button which pops up a GimpControllerView. Work in progress...
2004-07-21 02:50:20 +08:00
gimpactionview.c \
gimpactionview.h \
themes/Default/images/Makefile.am removed ... 2004-08-04 Sven Neumann <sven@gimp.org> * themes/Default/images/Makefile.am * themes/Default/images/stock-brush-generated-*-16.png: removed ... * themes/Default/images/stock-shape-*-16.png: ... and added back with more generic names. * libgimpwidgets/gimpstock.[ch] * app/widgets/gimpbrusheditor.c: changed accordingly. * app/tools/gimpinkoptions-gui.c: use the new stock icons here as well. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpblobeditor.[ch]: added a simple blob shape editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-05 02:15:41 +08:00
gimpblobeditor.c \
gimpblobeditor.h \
added GimpPaletteEntry typedef. 2002-03-08 Michael Natterer <mitch@gimp.org> * app/core/core-types.h: added GimpPaletteEntry typedef. * app/core/gimppalette.h: removed it here. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpeditor.[ch]: new widget which is the base class for everything which is a vbox and has a button area at the bottom. * app/widgets/gimpcontainerview.[ch]: derived from GimpEditor now. * app/widgets/gimpdataeditor.[ch]: a GimpEditor subclass which is the base class for the new data editors below. * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpchannellistview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpdocumentview.c * app/widgets/gimpitemlistview.c * app/widgets/gimplayerlistview.c * app/widgets/gimpvectorslistview.c * themes/Default/gtkrc: chagec accordingly. * app/gui/Makefile.am * app/gui/brush-editor.[ch] * app/gui/gradient-editor.[ch] * app/gui/palette-editor.[ch]: removed... * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimppaletteeditor.[ch]: ...and added back as GimpDataEditor subclasses. Lots of cleanup and stuff... * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/gradient-editor-commands.c * app/gui/gui-types.h * app/gui/palette-select.c * app/tools/gimpcolorpickertool.c: changed accordingly.
2002-03-08 08:27:45 +08:00
gimpbrusheditor.c \
gimpbrusheditor.h \
removed GimpFillType. 2001-06-29 Michael Natterer <mitch@gimp.org> * app/appenums.h: removed GimpFillType. * app/gimprc.c: parse the session-info's new "aux-info" field. * app/global_edit.[ch]: removed the old "Paste Named" dialog and prefixed all functions with "gimp_". * app/core/core-types.h: added GimpFillType. * app/core/gimpbrush.[ch]: new signal "spacing_changed". * app/gui/Makefile.am * app/gui/tools-commands.[ch]: one more file cut out of commands.[ch]. * app/gui/commands.[ch]: removed the tools stuff here. * app/gui/brush-select.[ch] * app/gui/dialogs-constructors.c: use the new GimpBrushFactoryView (see below). * app/gui/dialogs-commands.[ch] * app/gui/menus.[ch]: - Made it 64bit safe again by passing the dialog factory's identifiers as GQuarks, not as guints created by GPOINTER_TO_UINT(). - Added a "gchar *quark_string" field to GimpItemFactoryEntry which gets transformed into a GQuark by menus_create_item(). - Added SEPARATOR() and BRANCH() macros which make the *_entries[] arrays more readable. - Added a menu item to show/hide GimpImageDock's image menu. - Removed file_last_opened_cmd_callback(). * app/gui/edit-commands.c: the global_edit functions are "gimp_" prefixed now. * app/gui/file-commands.[ch]: added file_last_opened_cmd_callback() here. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpbrushfactoryview.[ch]: new widget: a GimpDataFactory subclass with a "spacing" scale. * app/widgets/gimpcontainereditor.[ch]: - Connect to the GimpContainerView's "select_item", "activate_item" and "context_item" signals here once instead of in each subclass and dispatch them via new virtual functions. - Added a convenience function which makes DND to the buttons much less painful for subclasses. * app/widgets/gimpbufferview.c * app/widgets/gimpdatafactoryview.[ch]: changed accordingly. * app/widgets/gimpdialogfactory.[ch]: - Added gimp_dialog_factory_dialog_raise() which can raise toplevel dialogs _and_ dockables (and creates them if they are not open yet). - Keep track of all created dialogs (not only toplevels). - Added an "aux_info" field to GimpSessionInfo which is a GList of gchar* and is saved in sessionrc. - Remember if GimpImageDock's image menu is visible by using an aux_info string. - The code did not become nicer with all those new constraints. I have to add comments before I forget how it works. * app/widgets/gimpdockbook.c: set the state of the "Show Image Menu" menu item before popping up the item factory. * app/widgets/gimpimagedock.[ch]: added gimp_image_dock_set_show_image_meu(). * plug-ins/gdyntext/gdyntext.c * plug-ins/perl/examples/fit-text * plug-ins/perl/examples/terral_text * plug-ins/perl/examples/tex-to-float: register all text rendering plug-ins under <Image>/Filters/Text * app/pdb/brush_select_cmds.c * app/pdb/drawable_cmds.c * app/pdb/edit_cmds.c * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/enums.pl * po/POTFILES.in: changed according to all the stuff above.
2001-06-30 03:25:03 +08:00
gimpbrushfactoryview.c \
gimpbrushfactoryview.h \
app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/brush-select.[ch] * app/gui/font-select.[ch] * app/gui/gradient-select.[ch] * app/gui/palette-select.[ch] * app/gui/pattern-select.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppdbdialog.[ch] * app/widgets/gimpdataselect.[ch] * app/widgets/gimpbrushselect.[ch] * app/widgets/gimpgradientselect.[ch] * app/widgets/gimppaletteselect.[ch] * app/widgets/gimppatternselect.[ch] * app/widgets/gimpfontselect.[ch]: ...and added here as a hierarchy of widgets. * app/widgets/gimpdatafactoryview.h: removed typdef GimpDataEditFunc, it's in widgets-types.h now. * app/gui/convert-dialog.c: changed accordingly. * app/core/gimp.[ch]: added vtable entries for creating, closing and setting PDB dialogs. * app/gui/gui-vtable.c: implement the vtable entries using the new widgets. * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/font_select.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/palette_select.pdb * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of the Gimp object to create / manage the selection dialogs. The generated files don't depend on GUI stuff any longer. * app/pdb/brush_select_cmds.c * app/pdb/font_select_cmds.c * app/pdb/gradient_select_cmds.c * app/pdb/palette_select_cmds.c * app/pdb/pattern_select_cmds.c: regenerated.
2004-07-10 03:14:59 +08:00
gimpbrushselect.c \
gimpbrushselect.h \
app/Makefile.am removed. 2001-06-26 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/color_transfer.[ch]: removed. * app/tools/Makefile.am * app/tools/gimpcolorbalancetool-transfer.[ch]: added. * app/tools/gimpcolorbalancetool.c: changed accordingly. * app/base/Makefile.am * app/base/tile-manager-crop.[ch]: formerly known as crop_buffer(). * app/tools/gimptexttool.c: changed accordingly. * app/context_manager.[ch]: added the global clipboard and the named buffer list here. * app/app_procs.c: don't call color_transfer_init() and don't free the buffer stuff (done by the context manager now). * app/errorconsole.c: don't #include "gui/commands.h" * app/global_edit.[ch]: removed lots of stuff which is now done by gui/edit-commands.* or the new GimpBuffer object. The "paste named" dialog will go away and this file will be moved to core/ soon. * app/image_new.c: no need to declare the global_buffer extern any more. * app/qmask.c: don't #include "global_edit.h" * app/core/Makefile.am * app/core/core-types.h * app/core/gimpbuffer.[ch]: new object (aka named buffer) * app/core/gimpcontext.[ch]: added a GimpBuffer attribute. * app/core/gimpimage.[ch]: one s/int/gboolean/. * app/core/gimppattern.c: hmm... * app/gui/commands.[ch]: split up in small files: * app/gui/Makefile.am * app/gui/edit-commands.[ch] * app/gui/file-commands.[ch] * app/gui/image-commands.[ch] * app/gui/select-commands.[ch] * app/gui/view-commands.[ch]: new files. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added the named buffer list & grid. * app/gui/file-new-dialog.[ch] * app/gui/menus.c * app/gui/palette-editor.c * app/gui/test-commands.c: changed accordingly. * app/pdb/edit_cmds.c * tools/pdbgen/pdb/edit.pdb: changed for the global_edit stuff. * app/widgets/Makefile.am * app/widgets/gimpbufferpreview.[ch] * app/widgets/gimpbufferview.[ch] * app/widgets/gimpcontainereditor.[ch]: new widgets. * app/widgets/gimpcontainerview-utils.c * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawablepreview.c * app/widgets/gimplayerlistview.c * app/widgets/gimppreview.c * app/widgets/widgets-types.h: changed accordingly for the new GimpBuffer object and it's views, misc. cleanups. * pixmaps/Makefile.am * pixmaps/paste-as-new.xpm * pixmaps/paste-into.xpm * pixmaps/paste.xpm: new pixmaps (they all look the same... Tigert? ;-) * po/POTFILES.in: added the new files.
2001-06-26 20:09:43 +08:00
gimpbufferview.c \
gimpbufferview.h \
app/core/gimpmarshal.list app/widgets/Makefile.am 2004-07-21 Michael Natterer <mitch@gimp.org> * app/core/gimpmarshal.list * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcellrendereraccel.[ch]: new cell renderer which displays an accelerator and allows to edit it (ripped out of libegg and modified). * app/widgets/gimpactionview.c: use the new renderer and connect to its "accel-edited" signal (its callback is one huge mess that needs to be cleaned up). Added ugly hack to work around GTK+ API limitation that seems to prevent implementing a shortcut editor in a sane way. * app/actions/file-actions.c * app/actions/image-actions.c * app/actions/tools-actions.c: added ugly hacks here, too. * app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut editor by Close.
2004-07-21 08:39:46 +08:00
gimpcellrendereraccel.c \
gimpcellrendereraccel.h \
added "gchar *stock_id" to the GimpViewable struct. It is used by the GUI 2003-02-26 Michael Natterer <mitch@gimp.org> * app/core/gimpviewable.[ch]: added "gchar *stock_id" to the GimpViewable struct. It is used by the GUI if the get_preview() functions return NULL. Default to GTK_STOCK_DIALOG_QUESTION. * app/core/gimptoolinfo.[ch]: set the tool's stock_id. Removed the cached GdkPixbuf. Don't implement any preview function so the GUI uses the stock_id. * app/tools/tool_manager.c: removed GdkPixbuf creation, removed the #warning about the buggy way we created the pixbuf. * app/gui/dialogs-constructors.c * app/gui/image-menu.c * app/tools/gimpcroptool.c * app/tools/gimphistogramtool.c * app/tools/gimpimagemaptool.c * app/tools/gimpmeasuretool.c * app/tools/gimptransformtool.c * app/widgets/gimptoolbox.c: use viewable->stock_id instead of tool_info->stock_id. * app/core/gimpbrush.c * app/core/gimpgradient.c * app/core/gimpimagefile.c * app/core/gimpundo.c: simplified get_preview() implementations: - never scale previews up, only down. - don't render white or checks backgrounds but simply return TempBufs with alpha and let the preview system do its job. - don't add padding but simply return previews smaller than requested. * app/display/gimpdisplayshell-render.[ch]: added "render_blend_white", a 2d lookup table for blending on white, just as the check lookup tables. Added "render_white_buf". * app/widgets/gimppreview.[ch]: changed a lot: - don't render the preview's border into the buffer. - added "GdkGC *border_gc" and draw the preview's border in expose() using gdk_draw_rectangle(). - added "GdkPixbuf *no_preview_pixbuf" and create it in gimp_preview_real_render() if gimp_viewable_get_preview() returned NULL. - factored the actual preview rendering out to gimp_preview_render_to_buffer(). Added configurable background rendering for the preview itself and it's padding area (the area the preview is larger than the buffer returned by gimp_viewable_get_preview()). - changed gimp_preview_render_and_flush() to gimp_preview_render_preview() and added "inside_bg" and "outside_bg" parameters. - use the new render buffers for blending on white. * app/widgets/gimpbrushpreview.c * app/widgets/gimpbufferpreview.c * app/widgets/gimpdrawablepreview.c * app/widgets/gimpgradientpreview.c * app/widgets/gimpimagepreview.c * app/widgets/gimppalettepreview.c * app/widgets/gimppatternpreview.c: don't create large white TempBufs to center the previews in but simply set the TempBuf's offsets to get them centered. Simplified & cleaned up many preview render functions. Pass the correct GimpPreviewBG modes to gimp_preview_render_preview(). * app/widgets/gimpcellrendererviewable.[ch]: new GtkCellRenderer class derived from GtkCellRendererPixbuf which knows how to use gimp_viewable_get_preview_size() and renders the viewable's stock item if no preview can be created. * app/widgets/gimpcontainertreeview.c: added a GtkTreeCellDataFunc which creates the preview pixbuf if needed so we don't create it unconditionally upon item insertion. Fixed preview size assertion to use GIMP_PREVIEW_MAX_SIZE, not "64". Block "selection_changed" while reordering the selected item. * app/widgets/gimpcontainerview.c: cosmetic. * app/widgets/gimpimagefilepreview.[ch] * app/widgets/gimptoolinfopreview.[ch] * app/widgets/gimpundopreview.[ch]: removed because the default implementation is good enough. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppreview-utils.c: changed accordingly. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs-menu.c * app/gui/dialogs.c * app/gui/image-menu.c * app/gui/toolbox-menu.c: register grid and tree view variants of the document history. Unrelated: * app/gui/gui.c (gui_exit_finish_callback): disconnect from signals earlier. * app/gui/user-install-dialog.c: create the "tool-options" subdir of the user's ~/.gimp-1.3 directory.
2003-02-27 00:17:10 +08:00
gimpcellrendererviewable.c \
gimpcellrendererviewable.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 19:14:29 +08:00
gimpchanneltreeview.c \
gimpchanneltreeview.h \
app/gui/Makefile.am removed... 2004-07-07 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/clipboard.[ch]: removed... * app/widgets/Makefile.am * app/widgets/gimpclipboard.[ch]: ...and added here. * app/actions/edit-commands.c * app/gui/gui.c: changed accordingly.
2004-07-07 22:38:23 +08:00
gimpclipboard.c \
gimpclipboard.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added new widget 2004-02-19 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcolorbar.[ch]: added new widget GimpColorBar. * app/tools/gimpcurvestool.c * app/tools/gimplevelstool.c * app/widgets/gimphistogrambox.[ch]: use GimpColorBar widgets. * app/widgets/gimpcolorframe.[ch]: fixed typos.
2004-02-20 03:56:04 +08:00
gimpcolorbar.c \
gimpcolorbar.h \
app/dialogs/Makefile.am removed... 2004-09-23 Michael Natterer <mitch@gimp.org> * app/dialogs/Makefile.am * app/dialogs/color-dialog.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcolordialog.[ch]: ...and added as widget. * app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM. * app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState. * app/widgets/gimpcolormapeditor.[ch] * app/widgets/gimpcolorpanel.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimptoolbox-color-area.c * app/actions/gradient-editor-commands.c * app/actions/view-commands.c: ported to GimpColorDialog. Removes a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-24 04:41:40 +08:00
gimpcolordialog.c \
gimpcolordialog.h \
libgimpwidgets/gimpwidgetsmarshal.list added signals ::added(), 2003-11-22 Michael Natterer <mitch@gimp.org> * libgimpwidgets/gimpwidgetsmarshal.list * libgimpwidgets/gimpcolordisplaystack.[ch]: added signals ::added(), ::removed() and ::reordered() and emit them in the resp. functions. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcolordisplayeditor.[ch]: new widget implementing an editable view on a GimpColorDisplayStack. Most code taken from below... * app/display/gimpdisplayshell-filter-dialog.c: ...and removed here. Only creates a GimpDialog around a GimpColorDisplayEditor now.
2003-11-22 23:54:12 +08:00
gimpcolordisplayeditor.c \
gimpcolordisplayeditor.h \
added virtual functions set_toggles_visible() and set_toggles_sensitive(). 2002-11-05 Michael Natterer <mitch@gimp.org> * libgimpwidgets/gimpcolorselector.[ch]: added virtual functions set_toggles_visible() and set_toggles_sensitive(). Added a stock_id. Emit "color_changed" and "channel_changed" on set_color() and set_channel() resp. * libgimpwidgets/gimpcolornotebook.[ch]: implement the new methods. Added gimp_color_notebook_set_has_page() to control which selectors a notebook contains. * libgimpwidgets/gimpcolorscales.[ch]: removed the toggle API and implement the new methods. * libgimpwidgets/gimpcolorselect.c: added toggle buttons for the channels so the widget doesn't need external ones. * app/gui/color-notebook.c: changed accordingly. * libgimpwidgets/gimpstock.[ch] * themes/Default/images/Makefile.am * themes/Default/images/stock-color-triangle-16.png: added a (bad) icon for the triangle color selector. * modules/colorsel_triangle.c: use the new icon. * modules/colorsel_water.c: use the "Paintbrush" icon for now. * app/widgets/gimpcoloreditor.[ch]: new widget for editing the FG/BG color featuring a color notebook, stock buttons for selecting the pages and a GimpPickButton. * app/widgets/Makefile.am * app/widgets/widgets-types.h: changed accordingly. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added a dockable wrapper for GimpColorEditor. * app/gui/menus.c: added it to the menus. Also added separate Layers, Channels and Paths entries. Bind <ctrl>L to the new callback so it doesn't always create a new layers dialog.
2002-11-05 08:02:56 +08:00
gimpcoloreditor.c \
gimpcoloreditor.h \
new enum GimpColorFrameMode. 2003-10-15 Michael Natterer <mitch@gimp.org> * app/widgets/widgets-enums.[ch]: new enum GimpColorFrameMode. * app/widgets/Makefile.am * app/widgets/gimpcolorframe.[ch]: new widget GimpColorFrame which shows a picked color in an optionmenu-selectable color space. Helps getting rid in InfoDialog. * app/gui/info-window.c: use it for the "extended" page. Cleaned up that page a lot so it can be made dockable in the next step. * app/tools/gimpcolorpickertool.[ch]: use it here too. Don't use InfoDialog any more (and do not depend on gui/ any more).
2003-10-15 23:16:50 +08:00
gimpcolorframe.c \
gimpcolorframe.h \
app/gui/Makefile.am removed... 2002-03-16 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/colormap-dialog.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcolormapeditor.[ch]: ...and added here. * app/gui/dialogs-constructors.c: changed accordingly. * themes/Default/images/Makefile.am * themes/Default/images/stock-menu-convert-grayscale.png * themes/Default/images/stock-menu-convert-indexed.png * themes/Default/images/stock-menu-convert-rgb.png * themes/Default/images/stock-menu-merge-down.png * themes/Default/images/stock-menu-reshow-filter.png * themes/Default/images/stock-menu-rotate-180.png * themes/Default/images/stock-menu-rotate-270.png * themes/Default/images/stock-menu-rotate-90.png * themes/Default/images/stock-menu-scale.png: new icons from Jimmac. * themes/Default/images/stock-menu-resize.png: my own doing. Someone needs to look at it :) * themes/Default/imagerc * libgimpwidgets/gimpstock.[ch]: added them. * app/gui/menus.c: use them.
2002-03-17 01:58:19 +08:00
gimpcolormapeditor.c \
gimpcolormapeditor.h \
configure.in new directory containing all widgets. Some of them will go to 2001-04-11 Michael Natterer <mitch@gimp.org> * configure.in * app/widgets/*: new directory containing all widgets. Some of them will go to libgimpwidgets. * app/color_panel.[ch] * app/gimpbrushpreview.[ch] * app/gimpconstrainedhwrapbox.[ch] * app/gimpcontainergridview.[ch] * app/gimpcontainerlistview.[ch] * app/gimpcontainerview.[ch] * app/gimpdatafactoryview.[ch] * app/gimpdock.[ch] * app/gimpdockable.[ch] * app/gimpdockbook.[ch] * app/gimpdrawablelistitem.[ch] * app/gimpdrawablelistview.[ch] * app/gimpdrawablepreview.[ch] * app/gimpgradientpreview.[ch] * app/gimpimagepreview.[ch] * app/gimplayerlistitem.[ch] * app/gimplayerlistview.{ch] * app/gimplistitem.[ch] * app/gimppalettepreview.[ch] * app/gimppatternpreview.[ch] * app/gimppreview.[ch] * app/gimptoolinfopreview.[ch] * app/gtkhwrapbox.[ch] * app/gtkvwrapbox.[ch] * app/gtkwrapbox.[ch] * app/histogramwidget.[ch]: removed from here. * app/Makefile.am * app/appenums.h * app/brush_select.c * app/channels_dialog.c * app/devices.c * app/gimpdnd.c * app/gimpdrawable-preview.c * app/gimphistogram.h * app/gradient_editor.c * app/gradient_select.c * app/indicator_area.c * app/info_window.c * app/palette.c * app/palette_select.c * app/pattern_select.c * app/qmask.c * app/test_commands.c * app/toolbox.c * app/pdb/color_cmds.c * app/tools/paint_options.c * app/tools/tool_options_dialog.c * tools/pdbgen/pdb/color.pdb: changed accordingly.
2001-04-11 09:13:53 +08:00
gimpcolorpanel.c \
gimpcolorpanel.h \
added descriptions to the GimpChannelType enum. 2003-03-12 Michael Natterer <mitch@gimp.org> * app/core/core-enums.[ch]: added descriptions to the GimpChannelType enum. * app/core/gimpimage.[ch]: added gimp_image_get_component_index() utility function which does the GIMP_RED_CHANNEL -> RED_PIX etc. mapping. Use it in all component getters/setters. * app/widgets/gimpcomponenteditor.[ch]: new widget implementing the component list using GtkListStore/GtkTreeView. Still a bit ugly because it uses the standard check instead of the eye icon. * app/widgets/gimpcomponentlistitem.[ch]: removed. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpvectorslistview.c: changed accordingly. * app/widgets/gimpchannellistview.[ch]: create a GimpComponentEditor and removed the old GtkList based stuff. * app/widgets/gimpitemlistview.[ch]: keep around a pointer to the GimpMenuFactory passed to the constructor. * app/gui/channels-menu.c (channels_menu_update): do the right thing if "data" is a GimpComponentEditor. * app/gui/channels-commands.[ch]: ditto. Implemented duplicating of components and component to selection (bug #61018).
2003-03-13 01:12:01 +08:00
gimpcomponenteditor.c \
gimpcomponenteditor.h \
Prepare for making an interface out of GimpContainerView: 2004-05-10 Michael Natterer <mitch@gimp.org> Prepare for making an interface out of GimpContainerView: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontainerbox.[ch]: new GimpContainerView subclass which implements GimpDocked interface and contains the vbox-with-scrolled-window stuff common to GimpContainerGridView and GimpContainerTreeView. * app/widgets/gimpcontainerview.[ch]: removed that functionality here. * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainertreeview.[ch]: derive them from GimpContainerBox. * app/gui/brush-select.c * app/gui/font-select.c * app/gui/gradient-select.c * app/gui/palette-select.c * app/gui/pattern-select.c * app/widgets/gimpcontainerpopup.c: changed accordingly.
2004-05-10 19:08:51 +08:00
gimpcontainerbox.c \
gimpcontainerbox.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added new widget, 2004-05-11 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontainercombobox.[ch]: added new widget, almost finished. * app/widgets/gimpcontainerview.[ch]: added convenience functions to get and set the GimpContainerView properties. * app/widgets/gimpcontainerbox.c: use the convenience functions. * app/gui/file-new-dialog.c: use the new GimpContainerComboBox. * etc/templaterc: use "pixels" as the unit for pixel sized templates.
2004-05-11 20:13:31 +08:00
gimpcontainercombobox.c \
gimpcontainercombobox.h \
app/Makefile.am removed. 2001-06-26 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/color_transfer.[ch]: removed. * app/tools/Makefile.am * app/tools/gimpcolorbalancetool-transfer.[ch]: added. * app/tools/gimpcolorbalancetool.c: changed accordingly. * app/base/Makefile.am * app/base/tile-manager-crop.[ch]: formerly known as crop_buffer(). * app/tools/gimptexttool.c: changed accordingly. * app/context_manager.[ch]: added the global clipboard and the named buffer list here. * app/app_procs.c: don't call color_transfer_init() and don't free the buffer stuff (done by the context manager now). * app/errorconsole.c: don't #include "gui/commands.h" * app/global_edit.[ch]: removed lots of stuff which is now done by gui/edit-commands.* or the new GimpBuffer object. The "paste named" dialog will go away and this file will be moved to core/ soon. * app/image_new.c: no need to declare the global_buffer extern any more. * app/qmask.c: don't #include "global_edit.h" * app/core/Makefile.am * app/core/core-types.h * app/core/gimpbuffer.[ch]: new object (aka named buffer) * app/core/gimpcontext.[ch]: added a GimpBuffer attribute. * app/core/gimpimage.[ch]: one s/int/gboolean/. * app/core/gimppattern.c: hmm... * app/gui/commands.[ch]: split up in small files: * app/gui/Makefile.am * app/gui/edit-commands.[ch] * app/gui/file-commands.[ch] * app/gui/image-commands.[ch] * app/gui/select-commands.[ch] * app/gui/view-commands.[ch]: new files. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added the named buffer list & grid. * app/gui/file-new-dialog.[ch] * app/gui/menus.c * app/gui/palette-editor.c * app/gui/test-commands.c: changed accordingly. * app/pdb/edit_cmds.c * tools/pdbgen/pdb/edit.pdb: changed for the global_edit stuff. * app/widgets/Makefile.am * app/widgets/gimpbufferpreview.[ch] * app/widgets/gimpbufferview.[ch] * app/widgets/gimpcontainereditor.[ch]: new widgets. * app/widgets/gimpcontainerview-utils.c * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawablepreview.c * app/widgets/gimplayerlistview.c * app/widgets/gimppreview.c * app/widgets/widgets-types.h: changed accordingly for the new GimpBuffer object and it's views, misc. cleanups. * pixmaps/Makefile.am * pixmaps/paste-as-new.xpm * pixmaps/paste-into.xpm * pixmaps/paste.xpm: new pixmaps (they all look the same... Tigert? ;-) * po/POTFILES.in: added the new files.
2001-06-26 20:09:43 +08:00
gimpcontainereditor.c \
gimpcontainereditor.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added new widget 2004-05-31 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontainerentry.[ch]: added new widget GimpContainerEntry, a GtkEntry with completion that implements the GimpContainerView interface. * app/tools/gimptextoptions.c (gimp_text_options_gui): added a GimpContainerEntry to select the font.
2004-06-01 01:53:25 +08:00
gimpcontainerentry.c \
gimpcontainerentry.h \
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
gimpcontainergridview.c \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 08:38:56 +08:00
gimpcontainergridview.h \
allow to create a GimpContainerEditor without a popup menu. 2003-03-22 Michael Natterer <mitch@gimp.org> * app/widgets/gimpcontainereditor.c: allow to create a GimpContainerEditor without a popup menu. * app/widgets/gimpcellrendererviewable.c: free the event we got from gdk_get_current_event(). * app/widgets/gimpcontainerview.c: check view->hash_table for being non-NULL before using it. Be prepared to be destroyed by as a result of calling gimp_context_set_foo(view->context, foo). * app/widgets/gimpcontainertreeview.[ch]: added tree_view->editable_cells and handle *all* mouse clicks in gimp_container_tree_view_button_press() (by returning TRUE). Start editing on double-click only. Use gtk_tree_view_set_cursor() instead of gtk_tree_selection_select_path() to avoid selected/focus confusion when the focus enters the widget. Be prepeared to be destroyed as a result of item selection. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontainerpopup.[ch]: new GtkWindow derived widget which pops up a selection of any GimpContainer/GimpContext combo. * app/widgets/gimpdatafactoryview.c * app/widgets/gimpitemtreeview.c: add the name cell to tree_view->editable_cells so it becomes editable. * app/tools/gimpblendoptions.c * app/tools/paint_options.c: use the new container popup for selecting brushes and gradients.
2003-03-23 00:26:11 +08:00
gimpcontainerpopup.c \
gimpcontainerpopup.h \
Started migration from GtkList to GtkTreeView: 2003-02-21 Michael Natterer <mitch@gimp.org> Started migration from GtkList to GtkTreeView: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontainertreeview.[ch]; new GimpContainerView subclass using GtkListStore/GtkTreeView. * app/widgets/widgets-enums.h: added GIMP_VIEW_TYPE_TREE to thje GimpViewType enum. * app/widgets/gimpcontainereditor.c: added GimpContainerTreeView to the switch() which selects the view type. * app/gui/dialogs-commands.c * app/gui/dialogs-constructors.[ch] * app/gui/dialogs-menu.c * app/gui/dialogs.c: added tree view versions of many dialogs. * app/widgets/gimppreview.[ch]: removed the get_size() virtual function and gimp_preview_calc_size(). * app/core/gimpviewable.[ch]: added virtual function get_preview_size() and gimp_viewable_calc_preview_size(). * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpdrawable.c * app/core/gimpgradient.c * app/core/gimpimage.c * app/core/gimppalette.c: added get_preview_size() implementations. * app/widgets/gimpbufferpreview.c * app/widgets/gimpdrawablepreview.c * app/widgets/gimpgradientpreview.c * app/widgets/gimpimagepreview.c * app/widgets/gimppalettepreview.c * app/widgets/gimpselectioneditor.c * app/widgets/gimpundopreview.c * app/display/gimpnavigationview.c: changed accordingly, removed get_size() implementations. * app/widgets/widgets-types.h: changed the first param of GimpItemGetNameFunc from GtkWidget to GObject. * app/widgets/gimpcontainerview-utils.c: accept a GimpViewable as object in the built-in get_name funcs. * app/widgets/gimpcomponentlistitem.c * app/widgets/gimpcontainergridview.c * app/widgets/gimplistitem.c * app/widgets/gimpmenuitem.c: changed accordingly.
2003-02-22 03:03:19 +08:00
gimpcontainertreeview.c \
gimpcontainertreeview.h \
app/widgets/gimpcellrenderertoggle.[ch] added public functions to emit the 2003-03-19 Michael Natterer <mitch@gimp.org> * app/widgets/gimpcellrenderertoggle.[ch] * app/widgets/gimpcellrendererviewable.[ch]: added public functions to emit the "clicked" signal. * app/widgets/gimpcontainertreeview.c: use them instead of g_signal_emit_by_name(). * app/widgets/Makefile.am * app/widgets/gimpcontainertreeview-dnd.[ch]: new files implementing DND for tree views. * app/widgets/gimpcontainertreeview.[ch]: added virtual functions drop_possible() and drop(). * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c: implement drop_possible() and drop().
2003-03-19 23:17:13 +08:00
gimpcontainertreeview-dnd.c \
gimpcontainertreeview-dnd.h \
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
gimpcontainerview.c \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 08:38:56 +08:00
gimpcontainerview.h \
some percentage updates. 2001-05-13 Michael Natterer <mitch@gimp.org> * TODO.xml: some percentage updates. * autogen.sh: correctly parse latest autoconf's broken "--version" string. * app/widgets/Makefile.am * app/widgets/gimpcontainerview-utils.[ch]: new files which provide a set of built-in get_name_func()s for GimpContainerView and GimpContainerMenu. * app/widgets/gimpcontainermenu.c * app/widgets/gimpcontainerview.c: use them. * app/widgets/gimpimagedock.c * app/gui/dialogs-constructors.c: removed the get_name_func()s here.
2001-05-13 20:16:55 +08:00
gimpcontainerview-utils.c \
gimpcontainerview-utils.h \
app/widgets/Makefile.am app/widgets/widgets-types.h made an object out of 2004-06-16 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontrollerinfo.[ch]: made an object out of the GimpControllerInfo struct. * app/widgets/gimpcontrollers.c: changed accordingly.
2004-06-16 19:11:32 +08:00
gimpcontrollerinfo.c \
gimpcontrollerinfo.h \
Started to fix bug #106920 in a more genreral way: 2004-06-16 Michael Natterer <mitch@gimp.org> Started to fix bug #106920 in a more genreral way: * libgimpwidgets/Makefile.am * libgimpwidgets/gimpwidgetstypes.h * libgimpwidgets/gimpwidgetsmarshal.list * libgimpwidgets/gimpcontroller.[ch]: new abstract base class which provides an API for pluggable input controller modules (mouse wheel, usb/midi stuff etc.). * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontrollerwheel.[ch]: subclass of the above which maps wheel mouse scroll events to controller events. * app/widgets/gimpcontrollers.[ch]: manager for controllers. reads $(gimpdir)/controllerrc and keeps a mapping of controller events to GtkActions. * app/gui/gui.c: initialize and shut down the controller stuff. * app/display/gimpdisplayshell-callbacks.c (gimp_display_shell_canvas_tool_events): if a wheel controller exists, dispatch GdkEventScroll to it first and return if it was handled.
2004-06-16 06:59:26 +08:00
gimpcontrollers.c \
gimpcontrollers.h \
app/tools/gimptool.[ch] added boolean return value to 2004-06-24 Michael Natterer <mitch@gimp.org> * app/tools/gimptool.[ch] * app/tools/tool_manager.[ch]: added boolean return value to GimpTool::key_press() which indicates if the event was handled. * app/tools/gimpcroptool.c * app/tools/gimpeditselectiontool.[ch] * app/tools/gimptransformtool.c * app/tools/gimpvectortool.c: return TRUE if the key event was handled. * app/tools/gimppainttool.c: removed key_press() implementation. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontrollerkeyboard.[ch]: new controller class which takes GdkEventKey and emits controller events for all combinations of modifiers and cursor keys. * app/widgets/gimpcontrollers.[ch]: added new function gimp_controllers_get_keyboard(). * app/display/gimpdisplayshell-callbacks.c: if a key event was not handled by the active tool, dispatch it to the keyboard controller. * etc/controllerrc: add a keyboard controller which is configured to do the same as the removed gimp_paint_tool_key_press().
2004-06-24 18:16:08 +08:00
gimpcontrollerkeyboard.c \
gimpcontrollerkeyboard.h \
Started to fix bug #106920 in a more genreral way: 2004-06-16 Michael Natterer <mitch@gimp.org> Started to fix bug #106920 in a more genreral way: * libgimpwidgets/Makefile.am * libgimpwidgets/gimpwidgetstypes.h * libgimpwidgets/gimpwidgetsmarshal.list * libgimpwidgets/gimpcontroller.[ch]: new abstract base class which provides an API for pluggable input controller modules (mouse wheel, usb/midi stuff etc.). * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontrollerwheel.[ch]: subclass of the above which maps wheel mouse scroll events to controller events. * app/widgets/gimpcontrollers.[ch]: manager for controllers. reads $(gimpdir)/controllerrc and keeps a mapping of controller events to GtkActions. * app/gui/gui.c: initialize and shut down the controller stuff. * app/display/gimpdisplayshell-callbacks.c (gimp_display_shell_canvas_tool_events): if a wheel controller exists, dispatch GdkEventScroll to it first and return if it was handled.
2004-06-16 06:59:26 +08:00
gimpcontrollerwheel.c \
gimpcontrollerwheel.h \
app/Makefile.am removed. Stuff now lives in app_procs.[ch] and in 2001-05-13 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/cursorutil.[ch]: removed. Stuff now lives in app_procs.[ch] and in widgets/gimpcursor.[ch] * app/appenv.h: added the "gimp_busy" boolean. * app/app_procs.[ch]: added the "busy" stuff here. * app/gui/gui.[ch]: "busy" stuff for the gui. * app/widgets/Makefile.am * app/widgets/gimpcursor.[ch]: exports only one function: gimp_cursor_new() which returns a GdkCursor which has to be destroyed. * app/apptypes.h * app/appenums.h: removed the cursor types. * app/widgets/widgets-types.h: added here. * app/tools/gimpeditselectiontool.[ch]: added gtkutil_compress_motion() here (will go to some utils file in widgets/). * app/tools/tools-types.h: #include "widgets/widgets-types.h" * app/dialog_handler.c * app/disp_callbacks.c * app/gdisplay.[ch] * app/nav_window.c * app/scroll.c * app/xcf.c * app/core/gimpimage-convert.c * app/core/gimpimage-duplicate.c * app/core/gimpimage.c * app/gui/file-open-dialog.c * app/tools/gimpblendtool.c * app/tools/gimpbucketfilltool.c * app/tools/gimpcroptool.c * app/tools/gimpfuzzyselecttool.c * app/tools/gimptransformtool.c * tools/pdbgen/pdb/image.pdb * app/pdb/image_cmds.c: use the new cursor and "busy" functions. * app/gdisplay.h * app/core/gimpbrush.c: added some ugly cross-includes. * app/context_manager.c * app/gdisplay_ops.c * app/gimprc.c * app/core/gimpdrawable-offset.c * app/gui/file-save-dialog.c * app/gui/gradient-editor.c * app/gui/preferences-dialog.c * app/tools/gimpbezierselecttool.c * app/tools/gimpbycolorselecttool.c * app/tools/gimpclonetool.c * app/tools/gimpcolorpickertool.c * app/tools/gimperasertool.c * app/tools/gimpfliptool.c * app/tools/gimpinktool.c * app/tools/gimpiscissorstool.c * app/tools/gimpmagnifytool.c * app/tools/gimpmeasuretool.c * app/tools/gimpmovetool.c * app/tools/gimppainttool.c * app/tools/gimprectselecttool.c * app/tools/gimprotatetool.c * app/tools/gimpselectiontool.c: removed inclusion of "cursorutil.h"
2001-05-14 05:51:20 +08:00
gimpcursor.c \
gimpcursor.h \
Dashed stroking is here... :-) 2003-12-27 Simon Budig <simon@gimp.org> Dashed stroking is here... :-) * app/core/gimpdrawable-stroke.c: actually use the dash pattern from the options * app/core/gimpscanconvert.c: Normalize the dash pattern, so that libart does the right thing. * app/core/gimpstrokeoptions.c: Fix default value for dash offset, handle the property_get for PROP_DASH_INFO correct. * app/widgets/gimpdasheditor.[ch] * app/widgets/Makefile.am * app/widgets/widgets-types.h: New widget to edit a dash pattern. * app/widgets/gimpstrokeeditor.c: Use it.
2003-12-28 03:25:19 +08:00
gimpdasheditor.c \
Made 2.0pre1 release. 2004-01-07 Sven Neumann <sven@gimp.org> * Made 2.0pre1 release.
2004-01-07 11:53:28 +08:00
gimpdasheditor.h \
added GimpPaletteEntry typedef. 2002-03-08 Michael Natterer <mitch@gimp.org> * app/core/core-types.h: added GimpPaletteEntry typedef. * app/core/gimppalette.h: removed it here. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpeditor.[ch]: new widget which is the base class for everything which is a vbox and has a button area at the bottom. * app/widgets/gimpcontainerview.[ch]: derived from GimpEditor now. * app/widgets/gimpdataeditor.[ch]: a GimpEditor subclass which is the base class for the new data editors below. * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpchannellistview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpdocumentview.c * app/widgets/gimpitemlistview.c * app/widgets/gimplayerlistview.c * app/widgets/gimpvectorslistview.c * themes/Default/gtkrc: chagec accordingly. * app/gui/Makefile.am * app/gui/brush-editor.[ch] * app/gui/gradient-editor.[ch] * app/gui/palette-editor.[ch]: removed... * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimppaletteeditor.[ch]: ...and added back as GimpDataEditor subclasses. Lots of cleanup and stuff... * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/gradient-editor-commands.c * app/gui/gui-types.h * app/gui/palette-select.c * app/tools/gimpcolorpickertool.c: changed accordingly.
2002-03-08 08:27:45 +08:00
gimpdataeditor.c \
gimpdataeditor.h \
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
gimpdatafactoryview.c \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 08:38:56 +08:00
gimpdatafactoryview.h \
app/Makefile.am removed, chopped... 2001-12-07 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/devices.[ch]: removed, chopped... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/gui/Makefile.am * app/widgets/gimpdeviceinfo.[ch] * app/widgets/gimpdevices.[ch] * app/gui/device-status-dialog.[ch] * app/gui/input-dialog.[ch]: ...and added here. Made GimpToolInfo a GimpContext subclass. Create a GimpDeviceManager struct in gimpdevices.c and attach it to the Gimp instance. * app/core/gimp.[ch]: removed gimp_create_context(). It was a bad idea in the first place beause it prevented GimpContext subclasses from being be properly registered with their Gimp instance. * app/core/gimpcontext.c: moved the stuff which used to be in gimp_create_context() back here. Added a "gimp" property which must be set on construction. Added a "dispose" implementation which removes the context from it's Gimp's context_list. * app/gimprc.c * app/core/gimptoolinfo.[ch] * app/display/gimpdisplayshell-callbacks.c * app/gui/brush-select.c * app/gui/dialogs-constructors.c * app/gui/gradient-editor.c * app/gui/gradient-select.c * app/gui/gui.c * app/gui/menus.c * app/gui/palette-editor.c * app/gui/palette-select.c * app/gui/pattern-select.c * app/gui/toolbox.c * app/tools/gimppainttool.c * app/tools/tool_manager.c * app/widgets/gimpimagedock.c: changed accordingly. * app/gui/tools-commands.[ch]: made all callback signatures the same. * app/gui/preferences-dialog.c: cleaned up the display_format_string GtkCombo code.
2001-12-08 01:39:51 +08:00
gimpdeviceinfo.c \
gimpdeviceinfo.h \
gimpdevices.c \
gimpdevices.h \
app/gui/Makefile.am removed... 2003-07-07 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/device-status-dialog.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpdevicestatus.[ch]: ...added here as widget. The thing is narrower now but not nicer and needs some polishing. * app/widgets/gimppropwidgets.[ch]: added gimp_prop_color_area_new() and gimp_prop_stock_image_new() (the latter is still unused). * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: made the device status a dockable. * app/gui/dialogs-menu.c * app/gui/image-menu.c * app/gui/toolbox-menu.c: changed accordingly. * app/gui/gui.c: update the device status dialog indirectly now using the new gui_device_change_notify() callback.
2003-07-07 21:37:19 +08:00
gimpdevicestatus.c \
gimpdevicestatus.h \
added some more dialog types. 2001-04-14 Michael Natterer <mitch@gimp.org> * app/menus.c: added some more dialog types. * app/gui/Makefile.am * app/gui/gimpdialogfactory.[ch]: removed again... * app/widgets/Makefile.am * app/widgets/gimpdialogfactory.[ch]: ...and added where it belongs. * app/gui/dialogs.c * app/widgets/gimpdock.c: changed #include's * app/gui/dialogs-commands.c: dialogs can be removed via the menu now. * app/widgets/gimpdockbook.c: ref the dockbook while the item factory is active because an item factory callback may destroy it (we need to add the hijacked GtkNotebook menu back to the notebook).
2001-04-15 00:37:28 +08:00
gimpdialogfactory.c \
gimpdialogfactory.h \
app/Makefile.am removed. 2001-05-08 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimpdnd.[ch]: removed. * app/widgets/Makefile.am * app/widgets/gimpdnd.[ch]: and moved here. * app/devices.c * app/docindex.c * app/interface.c * app/gui/about-dialog.c * app/gui/channels-dialog.c * app/gui/color-area.c * app/gui/color-select.c * app/gui/colormap-dialog.c * app/gui/gradient-editor.c * app/gui/indicator-area.c * app/gui/layers-dialog.c * app/gui/palette-editor.c * app/gui/palette-select.c * app/gui/toolbox.c * app/tools/gimpblendtool.c * app/tools/tool_manager.c * app/tools/tool_options_dialog.c: changed #includes accordingly.
2001-05-09 03:29:15 +08:00
gimpdnd.c \
gimpdnd.h \
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
gimpdock.c \
gimpdock.h \
gimpdockable.c \
gimpdockable.h \
gimpdockbook.c \
gimpdockbook.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new files implementing 2003-10-10 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpdocked.[ch]: new files implementing GimpDockedInterface, a GTypeInterface which must be implemented by all widgets which want to be packed into a GimpDockable. Has virtual functions similar to the ones GimpDockable had. * app/widgets/gimpdockable.[ch]: removed all virtual functions and all function pointers from the instance struct (also the ones just added in the commit below). Make sure only widgets implementing the GimpDockedIface are added and simply call the child's GimpDocked functions where we used to call our own virtual functions and function pointers. * app/widgets/gimpcoloreditor.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerview.c * app/widgets/gimpeditor.c * app/widgets/gimpimageeditor.c * app/widgets/gimpitemtreeview.c * app/widgets/gimpsessioninfo.c * app/widgets/gimptooloptionseditor.c * app/display/gimpnavigationview.c: implement GimpDockedIface. * app/gui/dialogs-constructors.c: removed all that get_preview_func(), set_context_func() etc. cruft since that's done by GimpDockedIface. It's really a file of constructors now. * app/gui/dialogs-menu.c: changed accordingly. * app/widgets/gimpimagedock.c: forgotten in the commit below.
2003-10-11 05:24:12 +08:00
gimpdocked.c \
gimpdocked.h \
app/Makefile.am removed. 2001-10-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/docindex.[ch]: removed. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpdocumentview.[ch]: new widget as replacement. * app/core/gimpcontext.[ch]: added context->imagefile property. * app/app_procs.c * app/file-save.c * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/file-open-dialog.c * app/gui/file-save-dialog.c * app/gui/gui.c * app/gui/menus.c * app/gui/test-commands.c: changed accordingly. * app/widgets/gimpcontainerview.[ch]: added "gboolean reorderable" property which needs to be set by subclasses. * app/widgets/gimpdrawablelistview.c: removed the "insert_item" implementation which was used to make the items reorderable. * app/widgets/gimpcontainerlistview.[ch]: make the list items reorderable depending on view->reorderable. * app/widgets/gimpbufferview.c: made it reorderable. * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpdatafactoryview.c: changed accordingly.
2001-10-23 01:27:46 +08:00
gimpdocumentview.c \
gimpdocumentview.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 19:14:29 +08:00
gimpdrawabletreeview.c \
gimpdrawabletreeview.h \
added GimpPaletteEntry typedef. 2002-03-08 Michael Natterer <mitch@gimp.org> * app/core/core-types.h: added GimpPaletteEntry typedef. * app/core/gimppalette.h: removed it here. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpeditor.[ch]: new widget which is the base class for everything which is a vbox and has a button area at the bottom. * app/widgets/gimpcontainerview.[ch]: derived from GimpEditor now. * app/widgets/gimpdataeditor.[ch]: a GimpEditor subclass which is the base class for the new data editors below. * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpchannellistview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpdocumentview.c * app/widgets/gimpitemlistview.c * app/widgets/gimplayerlistview.c * app/widgets/gimpvectorslistview.c * themes/Default/gtkrc: chagec accordingly. * app/gui/Makefile.am * app/gui/brush-editor.[ch] * app/gui/gradient-editor.[ch] * app/gui/palette-editor.[ch]: removed... * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimppaletteeditor.[ch]: ...and added back as GimpDataEditor subclasses. Lots of cleanup and stuff... * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/gradient-editor-commands.c * app/gui/gui-types.h * app/gui/palette-select.c * app/tools/gimpcolorpickertool.c: changed accordingly.
2002-03-08 08:27:45 +08:00
gimpeditor.c \
gimpeditor.h \
new marshaller VOID:STRING 2004-04-16 Michael Natterer <mitch@gimp.org> * app/core/gimpmarshal.list: new marshaller VOID:STRING * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpactiongroup.[ch] * app/widgets/gimpenumaction.[ch] * app/widgets/gimpstringaction.[ch]: added some completely unused GtkAction infrastructure.
2004-04-16 20:09:46 +08:00
gimpenumaction.c \
gimpenumaction.h \
app/widgets/Makefile.am app/widgets/widgets-types.h removed GimpEnumMenu. 2004-04-18 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu. * app/widgets/gimpenumwidgets.[ch]: moved widget constructors that don't use GimpEnumMenu from gimpenummenu.[ch] to these new files. * app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget using GimpEnumStore; replaces GimpEnumMenu. * app/widgets/gimpenumstore.[ch]: added new function gimp_enum_store_lookup_by_value(). * app/widgets/gimppropwidgets.[ch]: replaced gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new(). * app/gui/brush-select.[ch] * app/gui/convert-dialog.c * app/gui/layers-commands.c * app/gui/preferences-dialog.c * app/gui/resize-dialog.c * app/tools/gimpblendoptions.c * app/tools/gimpcolorbalancetool.c * app/tools/gimpcroptool.c * app/tools/gimpcurvestool.c * app/tools/gimplevelstool.c * app/tools/gimpmagnifytool.c * app/tools/gimppaintoptions-gui.c * app/tools/gimpselectionoptions.c * app/tools/gimptransformoptions.c * app/widgets/gimpcolorframe.c * app/widgets/gimpeditor.c * app/widgets/gimpgrideditor.c * app/widgets/gimphistogrameditor.c * app/widgets/gimpstrokeeditor.c * app/widgets/gimptemplateeditor.c * app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
2004-04-18 23:12:42 +08:00
gimpenumcombobox.c \
gimpenumcombobox.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added (yet unused) 2004-04-18 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpenumstore.[ch]: added (yet unused) GimpEnumStore, a GtkListStore for enum values.
2004-04-18 09:20:26 +08:00
gimpenumstore.c \
gimpenumstore.h \
app/widgets/Makefile.am app/widgets/widgets-types.h removed GimpEnumMenu. 2004-04-18 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu. * app/widgets/gimpenumwidgets.[ch]: moved widget constructors that don't use GimpEnumMenu from gimpenummenu.[ch] to these new files. * app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget using GimpEnumStore; replaces GimpEnumMenu. * app/widgets/gimpenumstore.[ch]: added new function gimp_enum_store_lookup_by_value(). * app/widgets/gimppropwidgets.[ch]: replaced gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new(). * app/gui/brush-select.[ch] * app/gui/convert-dialog.c * app/gui/layers-commands.c * app/gui/preferences-dialog.c * app/gui/resize-dialog.c * app/tools/gimpblendoptions.c * app/tools/gimpcolorbalancetool.c * app/tools/gimpcroptool.c * app/tools/gimpcurvestool.c * app/tools/gimplevelstool.c * app/tools/gimpmagnifytool.c * app/tools/gimppaintoptions-gui.c * app/tools/gimpselectionoptions.c * app/tools/gimptransformoptions.c * app/widgets/gimpcolorframe.c * app/widgets/gimpeditor.c * app/widgets/gimpgrideditor.c * app/widgets/gimphistogrameditor.c * app/widgets/gimpstrokeeditor.c * app/widgets/gimptemplateeditor.c * app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
2004-04-18 23:12:42 +08:00
gimpenumwidgets.c \
gimpenumwidgets.h \
Cleaned up and improved the message system: 2003-06-13 Michael Natterer <mitch@gimp.org> Cleaned up and improved the message system: * app/core/gimp.[ch]: added "const gchar *domain" to GimpMessageFunc (a NULL domain means the message is from the GIMP core, everything else is a plug-in). * app/errors.c: pass "domain == NULL" to gimp_message(). * tools/pdbgen/pdb/message.pdb: derive the message domain from the current plug-in's menu_path (evil hack but works reasonably well). * app/pdb/message_cmds.c: regenerated. * app/widgets/gimpwidgets-utils.[ch] (gimp_message_box): added a header showing the message domain and changed the dialog layout to follow the HIG more closely. * app/gui/error-console-dialog.[ch]: removed. * app/widgets/gimperrorconsole.[ch] * app/gui/error-console-commands.[ch] * app/gui/error-console-menu.[ch]: new files containing a re-implementation of the error console dialog. * app/gui/Makefile.am * app/gui/dialogs-constructors.c * app/gui/gui.c * app/gui/menus.c * app/widgets/Makefile.am * app/widgets/widgets-types.h: changed accordingly. * app/display/gimpprogress.c: added more spacing and removed the separator (more HIG compliant). * plug-ins/[most plug-ins].c: Changed lots of messages and progress strings: - Removed plug-in names from messages since that's automatically covered by "domain" now. - Put all filenames in ''. - Changed "Loading" to "Opening". - Added "..." to all progress messages. - Cleaned up all file open/save error messages to look the same and include g_strerror(errno). - Removed special casing for progress bars and *always* show them, not only if run_mode != GIMP_RUN_NONINTERACTIVE (we can't expect all plug-ins to do this correctly but need to hack the core to sort out unwanted progress bars). Unrelated: - Cleaned up indentation, spacing, #includes, coding style and other stuff while I was at all these files.
2003-06-13 22:37:00 +08:00
gimperrorconsole.c \
gimperrorconsole.h \
added gimp_message_box_repeat(). 2004-08-25 Sven Neumann <sven@gimp.org> * app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat(). * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimperrordialog.[ch]: added new dialog that adds a new GimpMessageBox for each message added. Fixes bug #92604. * app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box() functionality. * app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: manage GimpErrorDialog as singleton. * app/gui/gui-vtable.c (gui_message): use the new error dialog. * app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL domain. * app/widgets/gimperrorconsole.c (gimp_error_console_add): fail when being called with a NULL domain.
2004-08-26 01:58:52 +08:00
gimperrordialog.c \
gimperrordialog.h \
added enum GimpActiveColor which can be one of { FOREGROUND, BACKGROUND }, 2004-05-27 Michael Natterer <mitch@gimp.org> * app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which can be one of { FOREGROUND, BACKGROUND }, * app/widgets/Makefile.am * app/widgets/gimpfgbgeditor.[ch]: new widget implementing the FG/BG/Swap/Default color area known from the toolbox. * app/widgets/gimptoolbox-color-area.c: use the new widget. * app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and the color area by a GimpFgBgEditor.
2004-05-27 20:41:22 +08:00
gimpfgbgeditor.c \
gimpfgbgeditor.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new widget swallowing 2004-02-27 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpfiledialog.[ch]: new widget swallowing most of file-dialog-utils.[ch]'s functionality. * app/widgets/widgets-types.h: added "gpointer callback_data" to GimpItemFactorySetupFunc so the setup_funcs can create items in the same context as the item factory's default items. * app/widgets/gimpmenufactory.c (gimp_menu_factory_menu_new): pass "callback_data" to setup_func(). * app/gui/file-open-menu.[ch] * app/gui/file-save-menu.[ch]: use the passed callback_data when creating the menus and attach the file_proc to the menu items using g_object_set_data(). * app/gui/file-commands.[ch]: merged separate file type callbacks for open and save dialogs into one callback which simply calls gimp_file_dialog_set_file_proc(). * app/gui/file-dialog-utils.[ch]: removed file_dialog_new() and file_dialog_set_proc(). * app/gui/file-open-dialog.[ch] * app/gui/file-save-dialog.[ch]: use the new widget and removed global variables except the dialog pointer itself. * app/gui/image-menu.[ch] * app/gui/tool-options-menu.[ch] * app/gui/toolbox-menu.[ch]: changed accordingly.
2004-02-27 22:20:19 +08:00
gimpfiledialog.c \
gimpfiledialog.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added new widget that 2004-07-16 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpfileprocview.[ch]: added new widget that offers a treeview on file procedures. * app/widgets/gimpfiledialog.[ch]: replaced the file type option menu with the new GimpFileProcView widget. (gimp_file_dialog_set_image): reset the file type to Automatic (fixes bug #141535). * app/actions/file-commands.c * app/gui/file-open-dialog.[ch] * app/gui/file-save-dialog.[ch]: changed accordingly. * plug-ins/common/bz2.c * plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2" extension. It's redundant and breaks the code that sets the extension from the selected file-type. * plug-ins/common/dicom.c: register a shorter menu label. * plug-ins/common/gbr.c * plug-ins/common/gih.c * plug-ins/common/pat.c * plug-ins/common/url.c: register stock icons.
2004-07-17 05:24:39 +08:00
gimpfileprocview.c \
gimpfileprocview.h \
app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/brush-select.[ch] * app/gui/font-select.[ch] * app/gui/gradient-select.[ch] * app/gui/palette-select.[ch] * app/gui/pattern-select.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppdbdialog.[ch] * app/widgets/gimpdataselect.[ch] * app/widgets/gimpbrushselect.[ch] * app/widgets/gimpgradientselect.[ch] * app/widgets/gimppaletteselect.[ch] * app/widgets/gimppatternselect.[ch] * app/widgets/gimpfontselect.[ch]: ...and added here as a hierarchy of widgets. * app/widgets/gimpdatafactoryview.h: removed typdef GimpDataEditFunc, it's in widgets-types.h now. * app/gui/convert-dialog.c: changed accordingly. * app/core/gimp.[ch]: added vtable entries for creating, closing and setting PDB dialogs. * app/gui/gui-vtable.c: implement the vtable entries using the new widgets. * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/font_select.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/palette_select.pdb * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of the Gimp object to create / manage the selection dialogs. The generated files don't depend on GUI stuff any longer. * app/pdb/brush_select_cmds.c * app/pdb/font_select_cmds.c * app/pdb/gradient_select_cmds.c * app/pdb/palette_select_cmds.c * app/pdb/pattern_select_cmds.c: regenerated.
2004-07-10 03:14:59 +08:00
gimpfontselect.c \
gimpfontselect.h \
added gimp_container_freeze() / _thaw() around font list reloading. 2003-10-18 Michael Natterer <mitch@gimp.org> * app/text/gimp-fonts.c (gimp_fonts_load): added gimp_container_freeze() / _thaw() around font list reloading. * app/tools/gimp-tools.c (gimp_tools_init): added missing gimp_container_freeze(). * app/widgets/gimpcontainerview.c: connect to the container's "freeze" and "thaw" signals and empty / refill the view accordingly. Ignore "add", "remove" and "reorder" signals while the container is frozen. Fixes font list sorting after refresh and speeds up refreshing of fonts, brushes, patterns etc. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpfontview.[ch]: new widget for the font list/grid. * app/widgets/gimphelp-ids.h: added GIMP_HELP_FONT_REFRESH. * app/gui/dialogs-constructors.c: changed accordingly. * app/gui/Makefile.am * app/gui/fonts-commands.[ch] * app/gui/fonts-menu.[ch]: new files: a menu for the font view. * app/gui/menus.c (menus_init): register the new <Fonts> menu. * app/gui/preferences-dialog.c (prefs_dialog_new): removed the fonts refreshing hack from the "Environment" page.
2003-10-19 00:23:15 +08:00
gimpfontview.c \
gimpfontview.h \
added GimpPaletteEntry typedef. 2002-03-08 Michael Natterer <mitch@gimp.org> * app/core/core-types.h: added GimpPaletteEntry typedef. * app/core/gimppalette.h: removed it here. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpeditor.[ch]: new widget which is the base class for everything which is a vbox and has a button area at the bottom. * app/widgets/gimpcontainerview.[ch]: derived from GimpEditor now. * app/widgets/gimpdataeditor.[ch]: a GimpEditor subclass which is the base class for the new data editors below. * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpchannellistview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpdocumentview.c * app/widgets/gimpitemlistview.c * app/widgets/gimplayerlistview.c * app/widgets/gimpvectorslistview.c * themes/Default/gtkrc: chagec accordingly. * app/gui/Makefile.am * app/gui/brush-editor.[ch] * app/gui/gradient-editor.[ch] * app/gui/palette-editor.[ch]: removed... * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimppaletteeditor.[ch]: ...and added back as GimpDataEditor subclasses. Lots of cleanup and stuff... * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/gradient-editor-commands.c * app/gui/gui-types.h * app/gui/palette-select.c * app/tools/gimpcolorpickertool.c: changed accordingly.
2002-03-08 08:27:45 +08:00
gimpgradienteditor.c \
gimpgradienteditor.h \
app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/brush-select.[ch] * app/gui/font-select.[ch] * app/gui/gradient-select.[ch] * app/gui/palette-select.[ch] * app/gui/pattern-select.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppdbdialog.[ch] * app/widgets/gimpdataselect.[ch] * app/widgets/gimpbrushselect.[ch] * app/widgets/gimpgradientselect.[ch] * app/widgets/gimppaletteselect.[ch] * app/widgets/gimppatternselect.[ch] * app/widgets/gimpfontselect.[ch]: ...and added here as a hierarchy of widgets. * app/widgets/gimpdatafactoryview.h: removed typdef GimpDataEditFunc, it's in widgets-types.h now. * app/gui/convert-dialog.c: changed accordingly. * app/core/gimp.[ch]: added vtable entries for creating, closing and setting PDB dialogs. * app/gui/gui-vtable.c: implement the vtable entries using the new widgets. * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/font_select.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/palette_select.pdb * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of the Gimp object to create / manage the selection dialogs. The generated files don't depend on GUI stuff any longer. * app/pdb/brush_select_cmds.c * app/pdb/font_select_cmds.c * app/pdb/gradient_select_cmds.c * app/pdb/palette_select_cmds.c * app/pdb/pattern_select_cmds.c: regenerated.
2004-07-10 03:14:59 +08:00
gimpgradientselect.c \
gimpgradientselect.h \
removed the grid parasite related functions from here ... 2003-10-10 Henrik Brix Andersen <brix@gimp.org> * app/core/gimpimage-grid.[ch]: removed the grid parasite related functions from here ... * app/core/gimpgrid.[ch]: ... and added them here. While I was at it I also changed PROP_TYPE to PROP_STYLE and added blurbs to the properties * app/xcf/xcf-load.c * app/display/gimpdisplayshell.c: changed accordingly * app/widgets/Makefile.am * po/POTFILES.in * app/widgets/widgets-types.h * app/widgets/gimpgrideditor.[ch]: added a new GimpGridEditor widget - with a work-around for the fact that gimp_prop_coordinated_new() doesn't accept boundaries * app/gui/grid-dialog.h * app/gui/grid-dialog.c (grid_dialog_new): use the new GimpGridEditor widget, take a GimpImage as function parameter, assume GimpImages always have a GimpGrid. This simplifies the grid dialog. * app/gui/image-commands.c (image_configure_grid_cmd_callback): changed accordingly * app/core/core-types.h: moved typedef GimpGrid from here ... * app/config/config-types.h: ... to here to be able to use it in GimpCoreConfig * app/config/gimprc-blurbs.h * app/config/gimpcoreconfig.[ch]: added default_grid member * app/widgets/gimphelp-ids.h * themes/Default/images/preferences/Makefile.am * themes/Default/images/default-grid.png * app/gui/preferences-dialog.c: added UI for specifying default image grid * app/core/gimpimage.c (gimp_image_new): create a GimpGrid from core_config->default_grid * app/gui/image-menu.c (image_menu_update): the grid/guide entries in <Image>/View/ should always be sensitive ... * app/display/gimpdisplayshell.c (gimp_display_shell_init): ... but the grid entries should be disabled by default
2003-10-10 22:11:47 +08:00
gimpgrideditor.c \
gimpgrideditor.h \
app/Makefile.am removed... 2002-05-05 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch]: removed... * app/widgets/Makefile.am * app/widgets/gimphelp.[ch]: ...and added here. * app/widgets/widgets-enums.[ch]: added GimpHelpBrowserType here as registered enum. Added an evil hack with GimpCursorType so app/config/gimpguiconfig.h can include this file. * app/widgets/gimpcursor.c: added an assertion because of the changed GimpCursorType. * app/config/gimpguiconfig.[ch]: added a property for the help browser type. * app/gimprc.c * app/libgimp_glue.c * app/gui/preferences-dialog.c * tools/pdbgen/pdb/help.pdb * app/pdb/help_cmds.c: regenerated. Some nav_window cleanup before chopping: * app/nav_window.[ch]: removed the old preview code and use GimpNavigationPreviews only. Namespaceified all functions. Speak in terms of GimpDisplayShell, not GimpDisplay. Lots of internal cleanup. * app/gui/gui-types.h: removed NadiagtionDialog here... * app/display/display-types.h: ...and added it here. * app/display/gimpdisplayshell-callbacks.[ch]: added a callback for the navigation button and call nav_window_show_popup() from there. * app/display/gimpdisplayshell.c: free shell->nav_dialog unconditionally, connect to the new callback. * app/display/gimpdisplayshell-scale.c * app/display/gimpdisplayshell-scroll.c * app/gui/view-commands.c: changed accordingly. * app/widgets/gimppreview.c (gimp_preview_set_viewable): the assertion introduced recently was too tight, breaking GimpNavigationPreview. Changed it to do an "is a" check, not exact preview type matching. * app/widgets/gimpimagepreview.c: added quick-hack support for xres != yres. * app/widgets/gimpnavigationpreview.[ch]: made gimp_navigation_preview_grab_pointer() public so the nav_window can call it. Unrelated: * app/display/gimpdisplay.c: removed the gui/ dependency from this file by removing info_window stuff. * app/display/gimpdisplayshell.c (gimp_display_shell_flush): update the info_window here. * app/gui/dialogs-constructors.c (dialogs_indexed_palette_new): call gimp_dockable_set_context() like all other constructors. * app/undo.c * app/paint/gimppaintcore.h: some more include cleanup.
2002-05-06 03:17:41 +08:00
gimphelp.c \
gimphelp.h \
app/widgets/Makefile.am new file defining the available help topics. Work 2003-08-21 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/gimphelp-ids.h: new file defining the available help topics. Work in progress and totally unusable for matching to the help system. Stay tuned... * app/gui/about-dialog.c * app/gui/brushes-menu.c * app/gui/buffers-menu.c * app/gui/channels-commands.[ch] * app/gui/channels-menu.c * app/gui/edit-commands.c * app/gui/file-commands.c * app/gui/file-new-dialog.c * app/gui/file-open-dialog.c * app/gui/file-save-dialog.c * app/gui/gradients-commands.c * app/gui/gradients-menu.c * app/gui/image-menu.c * app/gui/layers-commands.[ch] * app/gui/layers-menu.c * app/gui/module-browser.c * app/gui/offset-dialog.c * app/gui/palettes-menu.c * app/gui/patterns-menu.c * app/gui/resize-dialog.c * app/gui/select-commands.c * app/gui/templates-menu.c * app/gui/tips-dialog.c * app/gui/toolbox-menu.c * app/gui/vectors-commands.[ch] * app/gui/vectors-menu.c: replaced literal HTML file paths by help IDs from gimphelp-ids.h. Renamed some menu callbacks to be consistent with similar ones. This is just an intermediate commit and not finished. While browsing all the menus, I noticed that our "x to selection" functions are not consistent at all. They should all offer the REPLACE,ADD,SUBTRACT,INTERSECT options: * app/core/gimpchannel.[ch]: added new function gimp_channel_new_from_alpha(). Removed gimp_channel_layer_alpha() and gimp_channel_layer_mask(). * app/core/gimpimage-mask.[ch]: added gimp_image_mask_select_alpha() and gimp_image_mask_select_component() which offer the full set of operation, feather and feather_radius parameters as the other selection functions. * app/core/gimpimage-mask-select.[ch]: removed gimp_image_mask_layer_alpha() and gimp_image_mask_layer_mask(). * app/gui/channels-commands.c (channels_channel_to_selection): use gimp_image_mask_select_component() instead of implementing it here. * app/gui/image-menu.c * app/gui/layers-commands.[ch]: offer the full choice of REPLACE,ADD,SUBTRACT,INTERSECT with "Alpha to Selection" and "Mask to Selection". * tools/pdbgen/pdb/selection.pdb: changed accordingly. * app/pdb/selection_cmds.c: regenerated.
2003-08-21 23:54:47 +08:00
gimphelp-ids.h \
Histogram cleanup: 2002-09-07 Michael Natterer <mitch@gimp.org> Histogram cleanup: * app/base/gimphistogram.c: Added g_return_if_fail() to all public functions, reordered stuff, cleanup (no logic changed). * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimphistogrambox.[ch]: new widget containing a GimpHistogramView and two range spinbuttons (as known from the threshold tool). Users only need to connect to the histogram view's "range_changed" signal. The spinbuttons are handled internally. * app/widgets/gimphistogramview.[ch]: define it's default size in the header. Make sure "start" is always smaller than "end". Emit "range_changed" in gimp_histogram_view_set_range(). * app/tools/gimplevelstool.c: changed accordingly. * app/tools/gimpthresholdtool.[ch]: removed the code which did the same and use the new widget. * app/tools/gimphistogramtool.[ch]: ditto. Removed the "intensity" info label. Cleanup.
2002-09-08 01:27:32 +08:00
gimphistogrambox.c \
gimphistogrambox.h \
Replaced the histogram tool by a histogram dialog: 2003-11-01 Sven Neumann <sven@gimp.org> Replaced the histogram tool by a histogram dialog: * themes/Default/images/Makefile.am * themes/Default/images/tools/stock-tool-histogram-[16|22].png: removed here ... * themes/Default/images/stock-histogram-[16|22].png: ,,, and added under these new names. * libgimpwidgets/gimpstock.[ch]: register the icons as GIMP_STOCK_HISTOGRAM and removed the histogram tool stock icons. * app/base/gimphistogram.c: don't crash when uncalculated values are requested from a GimpHistogram. Allow to reset the histogram by calling gimp_histogram_calculate() with a NULL region. * app/widgets/gimphistogrambox.[ch]: renamed the GimpHistogramView struct member to "view". * app/tools/gimpthresholdtool.c: changed accordingly. * app/widgets/gimphistogramview.[ch] (gimp_histogram_view_events): return TRUE when events were handled. * app/tools/Makefile.am * app/tools/gimp-tools.c * app/tools/gimphistogramtool.[ch]: removed the histogram tool. * app/widgets/Makefile.am * app/widgets/gimphelp-ids.h * app/widgets/widgets-types.h * app/widgets/gimphistogrameditor.[ch]: added GimpHistogramEditor. Has some rough edges still... * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/image-menu.c: register the new dialog instead of the histogram tool.
2003-11-01 10:39:34 +08:00
gimphistogrameditor.c \
gimphistogrameditor.h \
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
gimphistogramview.c \
gimphistogramview.h \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 08:38:56 +08:00
gimpimagedock.c \
gimpimagedock.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new GimpEditor 2003-02-20 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpimageeditor.[ch]: new GimpEditor subclass adding a GimpImage pointer and a virtual set_image() function. * app/widgets/gimpcolormapeditor.[ch] * app/widgets/gimpselectioneditor.[ch] * app/widgets/gimpundoeditor.[ch]: derive them from GimpImageEditor. Removed the public set_image() functions. * app/gui/colormap-editor-commands.c * app/gui/colormap-editor-menu.c: changed accordingly. * app/gui/dialogs-constructors.c: removed lots of code duplication and use the uniform GimpImageEditor API. Misc cleanups.
2003-02-20 23:40:15 +08:00
gimpimageeditor.c \
gimpimageeditor.h \
removed unused commented out prototype. 2002-05-08 Michael Natterer <mitch@gimp.org> * app/core/gimp.h: removed unused commented out prototype. * app/core/gimpimage.c (gimp_image_set_tattoo_state): fixed it again after I have b0rked it when using vectors instead of paths. * app/display/gimpdisplay.c: some comments and one more g_return_val_if_fail(). * app/widgets/gimpimagedock.c: more fixes for the subtle active_image <-> active_display difference. * tools/pdbgen/pdb/display.pdb (gimp_display_delete): call gimp_display_delete() instead of just destroying it's shell (eek). * app/pdb/display_cmds.c: regenerated. Added a special view type for the image list so we can implement stuff like deleting images which are left over from crashed plug-ins: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpimageview.[ch]: new widget: a view on the image container. * app/gui/Makefile.am * app/gui/images-commands.[ch]: new callbacks for it's context menu. * app/gui/dialogs-constructors.c: use the new widget instead of plain GimpContainerViews. * app/gui/menus.c: added an item_factory for it.
2002-05-08 20:39:01 +08:00
gimpimageview.c \
gimpimageview.h \
app/widgets/Makefile.am put the whole generic stuff from gui/menus.[ch] 2001-11-27 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/gimpitemfactory.[ch]: put the whole generic stuff from gui/menus.[ch] here (where generic == less_evil because it at least does not depend on particular menu entries). * app/gui/menus.[ch]: removed the stuff here. Only the global menu definitions and bad hacks to adjust them to our needs left. Removed all menus_get_foobar_factory() functions because we can use gtk_item_factory_from_path("<FooBar>") all over the place. * app/plug_in.c * app/display/gimpdisplayshell.c * app/gui/brushes-commands.c * app/gui/buffers-commands.c * app/gui/channels-commands.c * app/gui/dialogs.c * app/gui/documents-commands.c * app/gui/file-dialog-utils.c * app/gui/file-open-dialog.c * app/gui/file-save-dialog.c * app/gui/gradient-editor-commands.c * app/gui/gradients-commands.c * app/gui/gui.c * app/gui/layers-commands.c * app/gui/palettes-commands.c * app/gui/paths-dialog.c * app/gui/patterns-commands.c * app/gui/toolbox.c: changed accordingly. None of these files except gui/gui.c includes gui/menus.h any more.
2001-11-28 03:27:55 +08:00
gimpitemfactory.c \
gimpitemfactory.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 19:14:29 +08:00
gimpitemtreeview.c \
gimpitemtreeview.h \
gimplayertreeview.c \
gimplayertreeview.h \
Move away from creating all item_factories statically in menus_init() but 2003-01-10 Michael Natterer <mitch@gimp.org> Move away from creating all item_factories statically in menus_init() but create a new one for each place where one is needed: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpmenufactory.[ch]: new factory which creates and configures the GimpItemFactories it knows about on-the-fly. * app/widgets/gimpitemfactory.[ch]: added gimp_item_factory_update() which calls the "update_func". Added "gboolean update_on_popup" so item_factories can be configured to require manual updates (used for the <Image> factory). * app/gui/menus.[ch]: create a "global_menu_factory" and register all menus we have with it. Added various setup functions which do stuff like adding the "Open Recent" menu or reorder plug-in menu entries. Removed the debugging stuff... * app/gui/Makefile.am * app/gui/debug-commands.[ch]: ...and added it here. * app/gui/gui.c: create the <Toolbox>, the popup-<Image> and the <Paths> factories here because they are still global. * app/gui/plug-in-menus.[ch]: changed the "image_factory" parameters to "item_factory" and create/update the entries for the passed item_factory only. Makes the whole stuff much more straightforward. * app/plug-in/plug-ins.c: don't call plug_in_make_menu(). * app/display/gimpdisplay.[ch] * app/display/gimpdisplayshell.[ch]: added "menu_factory" and "popup_factory" parameters to gimp_display_new() and gimp_display_shell_new(). Create the menubar_factory and the qmask_factory dynamically. Pass the shell, not a Gimp to the QMask callbacks. Changed gimp_display_shell_set_menu_sensitivity() to gimp_display_shell_menu_update() and don't call it directly (it's a GimpItemFactory update_func now). Call gimp_item_factory_update() on the resp. factories instead. * app/gui/qmask-commands.c * app/display/gimpdisplayshell-callbacks.c * app/tools/gimpimagemaptool.c: changed accordingly. * app/widgets/gimpbrusheditor.c * app/widgets/gimpbrushfactoryview.[ch] * app/widgets/gimpbufferview.[ch] * app/widgets/gimpcolormapeditor.[ch] * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdialogfactory.[ch] * app/widgets/gimpdock.c * app/widgets/gimpdockbook.[ch] * app/widgets/gimpdocumentview.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpimageview.[ch] * app/widgets/gimpitemlistview.[ch] * app/widgets/gimppaletteeditor.[ch]: pass around lots of GimpMenuFactory pointers and menu_identifiers so all views can create their item_factories themselves. Unref the factories when they are no longer needed because they belong to the views now. * app/gui/dialogs-commands.c * app/gui/dialogs-constructors.c * app/gui/dialogs.c * app/gui/brush-select.c * app/gui/gradient-select.c * app/gui/palette-select.c * app/gui/pattern-select.c: changed accordingly. * app/gui/file-dialog-utils.[ch] (file_dialog_new): require menu_factory and menu_identifier parameters. * app/gui/file-open-dialog.[ch] * app/gui/file-save-dialog.[ch]: removed file_*_dialog_menu_init() (they went to menus.c as setup_funcs). Added file_*_dialog_set_type() and moved the <Load> and <Save> factory callbacks to file-commands.c * app/gui/file-commands.[ch]: changed accordingly. * app/gui/view-commands.c: changed the statusbar, menubar, rulers and guides callbacks to do their job only if the setting has actually changed. Don't update whole item factories afterwards. Instead, just change the state of the items that actually need update. Unrelated: * app/core/gimpchannel.c (gimp_channel_init): set "bounds_known" and friends to FALSE since we don't know that the new channel will be empty (fixes QMask and probably other stuff). * app/gui/image-commands.c * app/gui/vectors-commands.c: cleanup.
2003-01-11 01:55:53 +08:00
gimpmenufactory.c \
gimpmenufactory.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added new widget 2004-08-24 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox. * app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-24 07:22:46 +08:00
gimpmessagebox.c \
gimpmessagebox.h \
app/widgets/gimpnavigationpreview.c renamed these files to ... * app/widgets/gimpnavigationpreview.c * app/widgets/gimpnavigationpreview.h: renamed these files to ... * app/widgets/gimpnavigationview.c * app/widgets/gimpnavigationview.h: to these. And renamed the GimpNavigationPreview type to GimpNavigationView. Hopefully, this is the last change in file names for the Preview->View renaming process. * app/display/gimpnavigationeditor.c * app/widgets/Makefile.am * app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 08:42:46 +08:00
gimpnavigationview.c \
gimpnavigationview.h \
added GimpPaletteEntry typedef. 2002-03-08 Michael Natterer <mitch@gimp.org> * app/core/core-types.h: added GimpPaletteEntry typedef. * app/core/gimppalette.h: removed it here. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpeditor.[ch]: new widget which is the base class for everything which is a vbox and has a button area at the bottom. * app/widgets/gimpcontainerview.[ch]: derived from GimpEditor now. * app/widgets/gimpdataeditor.[ch]: a GimpEditor subclass which is the base class for the new data editors below. * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpchannellistview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpdocumentview.c * app/widgets/gimpitemlistview.c * app/widgets/gimplayerlistview.c * app/widgets/gimpvectorslistview.c * themes/Default/gtkrc: chagec accordingly. * app/gui/Makefile.am * app/gui/brush-editor.[ch] * app/gui/gradient-editor.[ch] * app/gui/palette-editor.[ch]: removed... * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimppaletteeditor.[ch]: ...and added back as GimpDataEditor subclasses. Lots of cleanup and stuff... * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/gradient-editor-commands.c * app/gui/gui-types.h * app/gui/palette-select.c * app/tools/gimpcolorpickertool.c: changed accordingly.
2002-03-08 08:27:45 +08:00
gimppaletteeditor.c \
gimppaletteeditor.h \
app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/brush-select.[ch] * app/gui/font-select.[ch] * app/gui/gradient-select.[ch] * app/gui/palette-select.[ch] * app/gui/pattern-select.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppdbdialog.[ch] * app/widgets/gimpdataselect.[ch] * app/widgets/gimpbrushselect.[ch] * app/widgets/gimpgradientselect.[ch] * app/widgets/gimppaletteselect.[ch] * app/widgets/gimppatternselect.[ch] * app/widgets/gimpfontselect.[ch]: ...and added here as a hierarchy of widgets. * app/widgets/gimpdatafactoryview.h: removed typdef GimpDataEditFunc, it's in widgets-types.h now. * app/gui/convert-dialog.c: changed accordingly. * app/core/gimp.[ch]: added vtable entries for creating, closing and setting PDB dialogs. * app/gui/gui-vtable.c: implement the vtable entries using the new widgets. * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/font_select.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/palette_select.pdb * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of the Gimp object to create / manage the selection dialogs. The generated files don't depend on GUI stuff any longer. * app/pdb/brush_select_cmds.c * app/pdb/font_select_cmds.c * app/pdb/gradient_select_cmds.c * app/pdb/palette_select_cmds.c * app/pdb/pattern_select_cmds.c: regenerated.
2004-07-10 03:14:59 +08:00
gimppaletteselect.c \
gimppaletteselect.h \
Sort the plugin menu entries with the mnemonics stripped. Avoids weird 2004-03-17 Simon Budig <simon@gimp.org> * app/gui/plug-in-menus.c: Sort the plugin menu entries with the mnemonics stripped. Avoids weird ordering in the "C" and "POSIX" locales. * app/widgets/gimpitemtreeview.c: make a simple click on the "New" Button use defaults and use shift-click for the new-dialog invocation. Some more useless button cleanup: * app/widgets/gimpdatafactoryview.c: only create an Edit button when the edit_function is set. * app/core/gimp.c: don't set an edit func for the patterns. * app/gui/patterns-menu.c: Don't create the "New", "Edit" and "Duplicate" Menu entries for the patterns. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppatternfactoryview.[ch]: New widget: gimp_pattern_factory_view. Necessary to be able to hide the "duplicate" button... * app/gui/dialogs-constructors.c: Use it.
2004-03-17 22:14:18 +08:00
gimppatternfactoryview.c \
gimppatternfactoryview.h \
app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 Michael Natterer <mitch@gimp.org> * app/gui/Makefile.am * app/gui/brush-select.[ch] * app/gui/font-select.[ch] * app/gui/gradient-select.[ch] * app/gui/palette-select.[ch] * app/gui/pattern-select.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppdbdialog.[ch] * app/widgets/gimpdataselect.[ch] * app/widgets/gimpbrushselect.[ch] * app/widgets/gimpgradientselect.[ch] * app/widgets/gimppaletteselect.[ch] * app/widgets/gimppatternselect.[ch] * app/widgets/gimpfontselect.[ch]: ...and added here as a hierarchy of widgets. * app/widgets/gimpdatafactoryview.h: removed typdef GimpDataEditFunc, it's in widgets-types.h now. * app/gui/convert-dialog.c: changed accordingly. * app/core/gimp.[ch]: added vtable entries for creating, closing and setting PDB dialogs. * app/gui/gui-vtable.c: implement the vtable entries using the new widgets. * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/font_select.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/palette_select.pdb * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of the Gimp object to create / manage the selection dialogs. The generated files don't depend on GUI stuff any longer. * app/pdb/brush_select_cmds.c * app/pdb/font_select_cmds.c * app/pdb/gradient_select_cmds.c * app/pdb/palette_select_cmds.c * app/pdb/pattern_select_cmds.c: regenerated.
2004-07-10 03:14:59 +08:00
gimppatternselect.c \
gimppatternselect.h \
gimppdbdialog.c \
gimppdbdialog.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new GtkAction subclass 2004-04-27 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppluginaction.[ch]: new GtkAction subclass which remembers the PlugInProcDef. * app/widgets/gimpactiongroup.[ch]: added "gpointer user_data" to the GimpActionGroup struct and to gimp_action_group_new(). Removed the user_data parameter from gimp_action_group_add_*_actions(). * app/widgets/gimpactionfactory.[ch]: changed accordingly. * app/actions/*-actions.[ch]: removed user_data from all setup_funcs. * app/actions/plug-in-actions.c: use a GimpPlugInAction and finally use the right user_data for the callback so plug-in callbacks have a proper context. * app/gui/plug-in-menus.[ch]: renamed plug_in_menus_create2() to plug_in_menus_setup(). * app/gui/image-menu.c * app/gui/toolbox-menu.c: changed accordingly.
2004-04-27 21:55:26 +08:00
gimppluginaction.c \
gimppluginaction.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass 2004-08-11 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring a label and a progressbar. Implements GimpProgressIterface. * app/widgets/gimpprogressdialog.[ch]: replaced label and progress by a GimpProgressBox. Delegate most progress functionality to it. * app/widgets/gimpwidgets-utils.[ch]: factored out utility function gimp_dialog_set_sensitive(). * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive): use it. * app/gui/file-open-location-dialog.c (file_open_location_response): embed the called file procedure's progress using a GimpProgressBox.
2004-08-11 06:21:56 +08:00
gimpprogressbox.c \
gimpprogressbox.h \
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
gimpprogressdialog.c \
gimpprogressdialog.h \
app/widgets/Makefile.am new files containing constructors for views on 2002-11-20 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/gimppropwidgets.[ch]: new files containing constructors for views on GObject properties. * app/gui/Makefile.am: the build preferences-dialog again. * app/gui/dialogs-constructors.c * app/gui/dialogs.c * app/gui/menus.c: added it back to the dialog system (as a non signleton to get the new model <-> view stuff some testing). * app/gui/preferences-dialog.c: here it is again, using property view widgets. Lots of stuff removed & simplified. Some things still #if 0'ed and/or non-working. No saving yet, stuff...
2002-11-21 03:45:03 +08:00
gimppropwidgets.c \
gimppropwidgets.h \
app/widgets/Makefile.am new files containing the code which 2004-06-28 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/gimpselectiondata.[ch]: new files containing the code which encodes/decodes all sorts of stuff to/from its GtkSelectionData representation. Used to live in gimpdnd.c * app/widgets/gimpdnd.c: use the new functions (unclutters the file quite a bit), converted tabs to spaces.
2004-06-29 04:39:54 +08:00
gimpselectiondata.c \
gimpselectiondata.h \
bumped version number to 1.3.9 2002-08-22 Michael Natterer <mitch@gimp.org> * configure.in: bumped version number to 1.3.9 * app/tools/gimpbycolorselecttool.[ch]: removed the ByColorDialog and cleaned up the code. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpselectioneditor.[ch]: added new widget GimpSelectionEditor with same same functionality as the old ByColorDialog which can be open all the time (independent of the active tool). * app/widgets/gimppreview.[ch]: added gimp_preview_new_by_type() so previews can be created without a viewable. * app/widgets/gimppreview-utils.[ch]: changed gimp_preview_type_from_viewable() to gimp_preview_type_from_viewable_type(). * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c: register the new dialog type.
2002-08-22 20:49:01 +08:00
gimpselectioneditor.c \
gimpselectioneditor.h \
Cleaned up session management and changed the format of sessionrc in a way 2003-10-10 Michael Natterer <mitch@gimp.org> Cleaned up session management and changed the format of sessionrc in a way that allows extensions without changing the format during the 2.0 cycle: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpsessioninfo.[ch]: new files implementing the whole GimpSessionInfo stuff (parsing, saving, restoring, utility functions). Save / parse the position of GimpDock's panes (bug #122964). * app/widgets/gimpdialogfactory.[ch]: removed saving, restoring and session related utility functions and use the ones from the new files above. * app/gui/session.c: removed parsing and use the new stuff. * app/widgets/gimpdock.[ch]: added new virtual functions GimpDock::set_aux_info() and GimpDock::get_aux_info(): * app/widgets/gimpimagedock.c: implement them and handle the "auto_follow_active" and "show_image_menu" properties. * app/widgets/gimpdockable.[ch]: added the same virtual functions to the GimpDockable class. Enables forward-compatible per-dockable session management (bug #122964). * app/gui/dialogs-commands.c * app/gui/gui.c: changed accordingly. * etc/sessionrc: ditto. Look at this file and update your own sessionrc manually if you don't want to lose it.
2003-10-10 23:59:12 +08:00
gimpsessioninfo.c \
gimpsessioninfo.h \
new marshaller VOID:STRING 2004-04-16 Michael Natterer <mitch@gimp.org> * app/core/gimpmarshal.list: new marshaller VOID:STRING * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpactiongroup.[ch] * app/widgets/gimpenumaction.[ch] * app/widgets/gimpstringaction.[ch]: added some completely unused GtkAction infrastructure.
2004-04-16 20:09:46 +08:00
gimpstringaction.c \
gimpstringaction.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added a (yet 2003-09-26 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpstrokeeditor.[ch]: added a (yet rudimentary) widget to view/edit a GimpStrokeOption. * app/widgets/gimptemplateeditor.[ch]: derive it directly from GtkVBox; it doesn't need any GimpEditor functionality.
2003-09-27 01:33:49 +08:00
gimpstrokeeditor.c \
gimpstrokeeditor.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new widget chopped out 2003-04-11 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptemplateeditor.[ch]: new widget chopped out of file-new-dialog.c * app/gui/file-new-dialog.c: use it.
2003-04-11 21:17:23 +08:00
gimptemplateeditor.c \
gimptemplateeditor.h \
added gimp_list_uniquefy_name() utility function. 2003-04-06 Michael Natterer <mitch@gimp.org> * app/core/gimplist.[ch]: added gimp_list_uniquefy_name() utility function. * app/core/gimpdatalist.c * app/core/gimpitem.c: use it here instead of duplicating almost the same code. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptemplateview.[ch]: new widget for editing the template list. * app/gui/dialogs-constructors.c: use it. * app/gui/Makefile.am * app/gui/templates-commands.[ch] * app/gui/templates-menu.[ch]: new files implementing the context menu for the template list. * app/gui/menus.c: register the new menu with the menu factory. * app/gui/file-commands.c (file_new_template_callback): uniquefy the new template's name. * app/gui/documents-commands.c: fixed typo.
2003-04-06 19:21:56 +08:00
gimptemplateview.c \
gimptemplateview.h \
app/config/gimpconfig.[ch] added a reset method to GimpConfigInterface. 2003-02-01 Sven Neumann <sven@gimp.org> * app/config/gimpconfig.[ch] * app/config/gimpconfig-utils.[ch]: added a reset method to GimpConfigInterface. Added the new function gimp_config_reset() * app/text/gimptext.c: added a GimpConfigInterface to GimpText. * app/widgets/Makefile.am * app/widgets/gimptexteditor.[ch]: new files that hold the simple text editor dialog used by the text tool. * app/widgets/gimppropwidgets.[ch]: added new widget constructor gimp_prop_scale_entry_new(). * app/tools/gimptexttool.[ch]: replaced old-style ToolOptions with a GimpText object. Connect text layers to the text tool by means of their GimpText objects. Still work in progress ...
2003-02-02 05:50:21 +08:00
gimptexteditor.c \
gimptexteditor.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new widget ripped out 2004-02-26 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpthumbbox.[ch]: new widget ripped out of the file open dialog. * app/gui/file-open-dialog.c: use it.
2004-02-26 21:48:42 +08:00
gimpthumbbox.c \
gimpthumbbox.h \
g_strdup() the stock_id passed to gimp_tool_info_new() because the 2002-03-14 Michael Natterer <mitch@gimp.org> * app/core/gimptoolinfo.c: g_strdup() the stock_id passed to gimp_tool_info_new() because the caller's memory may disappear after registering the tool (tool modules). Made a GimpDock out of the toolbox: * app/gui/Makefile.am * app/gui/color-area.[ch] * app/gui/indicator-area.[ch] * app/gui/toolbox.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptoolbox-color-area.[ch] * app/widgets/gimptoolbox-indicator-area.[ch] * app/widgets/gimptoolbox.[ch]: ...and added here. * app/widgets/gimpdock.[ch]: don't set a minimal width. Added a "destroy_if_empty" boolean so we can prevent destruction of the toolbox if it's last dockable is removed. Added gimp_dock_construct() which is called from GimpImageDock and GimpToolbox. * app/widgets/gimpimagedock.[ch]: Default to not showing the image menu, set a minimal width here, misc. minor cleanup. * app/widgets/gimpdockbook.c: some more GIMP_IS_IMAGE_DOCK() checks, fixed dnd widget creation. * app/widgets/gimpdialogfactory.[ch]: changed gimp_dialog_factories_toggle() to take just the toolbox_factory as parameter. When restoring the session use the created dock's dialog factory to create dockables, not the the factory we created the dock from (for the toolbox). * app/display/gimpdisplayshell-callbacks.c: changed accordingly. * app/gui/dialogs.[ch]: create an own dialog factory for the toolbox and set dialogs_toolbox_new() as it's new_dock_func. * app/gui/dialogs-constructors.[ch]: changed dialogs_toolbox_get() accordingly. * app/gui/dialogs-commands.[ch]: added dialogs_show_toolbox(), ckeck if a dock is really a GimpImageDock before casting. * app/gui/gui.c * app/gui/menus.c * app/widgets/gimppaletteeditor.c: changed accordingly. * app/gui/color-notebook.c * app/gui/color-select.c * app/gui/colormap-dialog.c * app/gui/palette-editor-commands.c: removed useless inclusion of "gui/color-area.h". * themes/Default/gtkrc: set "gimp-dock-style" for GimpToolbox widgets.
2002-03-15 01:07:02 +08:00
gimptoolbox.c \
gimptoolbox.h \
gimptoolbox-color-area.c \
gimptoolbox-color-area.h \
app/widgets/Makefile.am new files containing the toolbox' drop callbacks. 2003-06-06 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/gimptoolbox-dnd.[ch]: new files containing the toolbox' drop callbacks. Exports gimp_toolbox_dnd_init(). * app/widgets/gimptoolbox.c: removed the callbacks and all the "core/" includes they needed and call gimp_toolbox_dnd_init().
2003-06-06 23:14:47 +08:00
gimptoolbox-dnd.c \
gimptoolbox-dnd.h \
app/widgets/Makefile.am new toolbox area which shows the active image. 2004-05-31 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which shows the active image. * app/config/gimpguiconfig.[ch] * app/config/gimprc-blurbs.h: added config options to control the visibility of the toolbox' color, indicator and image areas. * app/widgets/gimptoolbox.[ch]: added the image area and honor the new config options. Put the various areas into their own wrap box. * app/widgets/gimptoolbox-dnd.c: changed accordingly. * app/widgets/gimphelp-ids.h: added a help ID for the image area. * app/widgets/gimptoolbox-indicator-area.c: made the previews a bit larger, cleanup. * app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for the new config options. * themes/Default/images/preferences/Makefile.am * themes/Default/images/preferences/toolbox.png: a (wrong) icon for the "Toolbox" prefs page. Needs to be replaced.
2004-06-01 04:30:52 +08:00
gimptoolbox-image-area.c \
gimptoolbox-image-area.h \
g_strdup() the stock_id passed to gimp_tool_info_new() because the 2002-03-14 Michael Natterer <mitch@gimp.org> * app/core/gimptoolinfo.c: g_strdup() the stock_id passed to gimp_tool_info_new() because the caller's memory may disappear after registering the tool (tool modules). Made a GimpDock out of the toolbox: * app/gui/Makefile.am * app/gui/color-area.[ch] * app/gui/indicator-area.[ch] * app/gui/toolbox.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptoolbox-color-area.[ch] * app/widgets/gimptoolbox-indicator-area.[ch] * app/widgets/gimptoolbox.[ch]: ...and added here. * app/widgets/gimpdock.[ch]: don't set a minimal width. Added a "destroy_if_empty" boolean so we can prevent destruction of the toolbox if it's last dockable is removed. Added gimp_dock_construct() which is called from GimpImageDock and GimpToolbox. * app/widgets/gimpimagedock.[ch]: Default to not showing the image menu, set a minimal width here, misc. minor cleanup. * app/widgets/gimpdockbook.c: some more GIMP_IS_IMAGE_DOCK() checks, fixed dnd widget creation. * app/widgets/gimpdialogfactory.[ch]: changed gimp_dialog_factories_toggle() to take just the toolbox_factory as parameter. When restoring the session use the created dock's dialog factory to create dockables, not the the factory we created the dock from (for the toolbox). * app/display/gimpdisplayshell-callbacks.c: changed accordingly. * app/gui/dialogs.[ch]: create an own dialog factory for the toolbox and set dialogs_toolbox_new() as it's new_dock_func. * app/gui/dialogs-constructors.[ch]: changed dialogs_toolbox_get() accordingly. * app/gui/dialogs-commands.[ch]: added dialogs_show_toolbox(), ckeck if a dock is really a GimpImageDock before casting. * app/gui/gui.c * app/gui/menus.c * app/widgets/gimppaletteeditor.c: changed accordingly. * app/gui/color-notebook.c * app/gui/color-select.c * app/gui/colormap-dialog.c * app/gui/palette-editor-commands.c: removed useless inclusion of "gui/color-area.h". * themes/Default/gtkrc: set "gimp-dock-style" for GimpToolbox widgets.
2002-03-15 01:07:02 +08:00
gimptoolbox-indicator-area.c \
gimptoolbox-indicator-area.h \
app/widgets/Makefile.am added a simple utility function 2003-10-20 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/gimptooldialog.[ch]: added a simple utility function gimp_tool_dialog_new() that creates a GimpVieawableDialog based on GimpToolInfo and registers it with the toplevel dialog factory. * app/tools/gimpbrightnesscontrasttool.c * app/tools/gimpcolorbalancetool.c * app/tools/gimpcolorizetool.c * app/tools/gimpcolorpickertool.c * app/tools/gimpcurvestool.c * app/tools/gimphistogramtool.c * app/tools/gimphuesaturationtool.c * app/tools/gimpimagemaptool.[ch] * app/tools/gimplevelstool.c * app/tools/gimpmeasuretool.c: use the new functionality; removed the shell_identifier since it can be created from the tool name. * app/tools/gimpperspectivetool.c * app/tools/gimpposterizetool.c * app/tools/gimprotatetool.c * app/tools/gimpscaletool.c * app/tools/gimpsheartool.c * app/tools/gimpthresholdtool.c * app/tools/gimptransformtool.[ch]: removed the shell_identifier here as well. Should also be ported to gimp_tool_dialog_new(). * NEWS: removed stuff that isn't new at all.
2003-10-21 05:27:34 +08:00
gimptooldialog.c \
gimptooldialog.h \
added a GimpContainer of tool options presets. 2003-09-29 Michael Natterer <mitch@gimp.org> * app/core/gimptoolinfo.[ch]: added a GimpContainer of tool options presets. * app/core/gimptooloptions.[ch] (gimp_tool_options_set_property): silently accept setting the *same* tool_info again. (gimp_tool_options_build_filename): is public now. * app/tools/gimp-tools.c (gimp_tools_restore,save): load and save the presets container. * app/gui/tool-options-dialog.[ch]: removed. * app/gui/tool-options-commands.[ch] * app/gui/tool-options-menu.[ch]: new files implementing a menu for the new GimpToolOptionsEditor widget. Has submenus for saving, loading, and deleting tool options to/from the tool_info->options_presets container. * app/gui/Makefile.am * app/gui/dialogs-constructors.c * app/gui/menus.c: changed accordingly. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptooloptionseditor.[ch]: the tool options dialog as proper widget. The "Load" and "Save" buttons still do the same stuff as before. Will make them use the new presets since making them do something useful was the reason for this whole change. * app/widgets/gimphelp-ids.h: added missing help IDs for the tool options dialog.
2003-09-30 04:26:09 +08:00
gimptooloptionseditor.c \
gimptooloptionseditor.h \
Started making the toolbox configurable. Addresses bug #105764. Not 2004-05-10 Michael Natterer <mitch@gimp.org> Started making the toolbox configurable. Addresses bug #105764. Not finished yet. * app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible" and made it a GObject property. * app/tools/gimp-tools.[ch]: added new function gimp_tools_get_default_order() which returns a GList of tool identifiers. * app/actions/tools-actions.c * app/actions/tools-commands.[ch]: added actions & callbacks for toggling the "visible" boolean and for resetting all tools. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptoolview.[ch]: new widget which allows to toggle a tool's visibility and to reorder the tools. * app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash" and pack all tool buttons into the same wrap box. Connect to "reoder" of the tool container and to "notify::visible" of all tool infos and update the toolbox accordingly. * app/gui/dialogs-constructors.c: create a GimpToolView for the tools list/grid. * app/menus/menus.c: register a <Tools> menu for the dialog above. * menus/Makefile.am * menus/tools-menu.xml: added the menu.
2004-05-10 08:41:57 +08:00
gimptoolview.c \
gimptoolview.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new GtkUIManager 2004-04-21 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds API to update all action groups and knows which UIs it can create from which XML files. * app/widgets/gimpmenufactory.[ch]: register the XML file basenames along with path of their toplevel menus. Create GimpUIManagers instead of GtkUIManagers and register the XML files and menu paths with them. * app/gui/menus.c: register all XML files and their toplevel menu paths. * app/widgets/gimpeditor.[ch]: also create a GimpUIManager when creating the GtkItemFactory. Added "const gchar *ui_identifier" parameter to gimp_editor_create_menu(). * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpitemtreeview.[ch]: added "ui_identifier" parameters to all constructors. * app/widgets/gimpbrusheditor.c * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpcolormapeditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpdocumentview.c * app/widgets/gimperrorconsole.c * app/widgets/gimpfontview.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpimageview.c * app/widgets/gimppaletteeditor.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimptemplateview.c * app/widgets/gimptooloptionseditor.c * app/gui/dialogs-constructors.c * app/gui/gradient-select.c * app/gui/palette-select.c * app/gui/pattern-select.c: pass UI identifiers to the changed functions above. * app/display/gimpdisplayshell.[ch]: added a GimpUIManager for the menubar (menubar creating code still commented out). * app/display/gimpdisplay.c * app/gui/gui-vtable.c: update the ui manager.
2004-04-22 00:33:17 +08:00
gimpuimanager.c \
gimpuimanager.h \
Reimplemented the undo history: 2003-02-20 Michael Natterer <mitch@gimp.org> Reimplemented the undo history: * app/Makefile.am * app/undo_history.[ch]: removed. Changes/cleanups to the undo system to enable/simplify the new undo history implementation: * app/core/core-types.h: removed enum undo_event_t. Removed the GimpImage parameter from GimpUndoPopFunc and GimpUndoFreeFunc because GimpUndo has a GimpImage pointer now (see below). * app/core/core-enums.[ch]: added enum GimpUndoEvent. Added an enum value for REDO_EXPIRED. * app/core/gimpimage.[ch]: added a GimpUndo pointer to the "undo_event" signal which needs to be passed for all events except UNDO_FREE. * app/display/gimpdisplayshell-handlers.c: changed accordingly. * app/core/gimpundo.[ch]: added a GimpImage pointer to the GimpUndo struct. Removed GimpImage parameters all over the place. Added preview stuff. The preview creation needs to be triggered explicitly using gimp_undo_create_preview() because the GimpUndo can't know when it's possible to create the preview. * app/core/gimpimage-undo-push.c * app/paint/gimppaintcore-undo.c * app/tools/gimptransformtool-undo.c: changed accordingly, cleanup. * app/core/gimpundostack.[ch]: ditto. Return the freed undo from gimp_undo_stack_free_bottom(). Removed unused container signal handlers. * app/core/gimpimage-undo.c: free the redo stack the same way old undos are freed (from bottom up). Emit "undo_event" with event == REDO_EXPIRED for each removed redo. * app/core/gimpmarshal.list: added new marshallers. New undo history implementation: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpundoeditor.[ch] * app/widgets/gimpundopreview.[ch]: new widgets for the undo step previews and the history itself. * app/widgets/gimppreview-utils.c: added GimpUndoPreview to the list of possible preview types. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs-menu.c * app/gui/dialogs.c * app/gui/image-menu.c * app/gui/toolbox-menu.c: removed the old and added the new undo history to the dialog factory and the various dialog menus. * app/widgets/gimpdnd.[ch]: don't warn if a GType has no corresponding DND type. Instead, return FALSE from the function that failed. * app/widgets/gimppreview.c: check the return value of gimpdnd functions. Not only add drag sources but also remove them when no longer needed. * app/widgets/gimpselectioneditor.h: removed unneeded inclusion of "gui/gui-types.h".
2003-02-20 20:47:42 +08:00
gimpundoeditor.c \
gimpundoeditor.h \
app/widgets/Makefile.am app/widgets/widgets-types.h 2004-05-08 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpunitcombobox.[ch] * app/widgets/gimpunitstore.[ch]: added a prototype of a unit menu based on GtkComboBox. Will move this to libgimpwidgets later... * app/display/gimpstatusbar.[ch]: use the new GimpUnitComboBox and GimpUnitStore. * themes/Default/gtkrc * themes/Small/gtkrc: hardcode the appearance of the GimpUnitComboBox. It uses a hack that doesn't work in list mode.
2004-05-08 06:16:15 +08:00
gimpunitcombobox.c \
gimpunitcombobox.h \
gimpunitstore.c \
gimpunitstore.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 19:14:29 +08:00
gimpvectorstreeview.c \
gimpvectorstreeview.h \
app/widgets/gimppreview.c renamed these two files to... * app/widgets/gimppreview.c * app/widgets/gimppreview.h: renamed these two files to... * app/widgets/gimpview.c * app/widgets/gimpview.h: ... these files. Also renamed GimpPreview to GimpView. This is the first step of the great Preview->View renaming process. * app/actions/palettes-commands.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpnavigationview.c * app/gui/palette-import-dialog.c * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpaction.c * app/widgets/gimpactiongroup.c * app/widgets/gimpbrusheditor.c * app/widgets/gimpbufferview.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainergridview.h * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.c * app/widgets/gimpdockbook.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpnavigationpreview.c * app/widgets/gimpnavigationpreview.h * app/widgets/gimppaletteeditor.c * app/widgets/gimppreview-popup.c * app/widgets/gimppropwidgets.c * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.c * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpviewabledialog.c * app/widgets/widgets-types.h: changed accordingly.
2004-08-25 01:16:46 +08:00
gimpview.c \
gimpview.h \
app/widgets/gimppreview-popup.c renamed these files... * app/widgets/gimppreview-popup.c * app/widgets/gimppreview-popup.h: renamed these files... * app/widgets/gimpview-popup.c * app/widgets/gimpview-popup.h: .. to these files, and changed the GimpPreviewPopup type to GimpViewPopup. * app/widgets/gimppreviewrenderer.c * app/widgets/gimppreviewrenderer.h: renamed these files... * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: .. to these files, and changed GimpPreviewRenderer to GimpViewRenderer. This is the second step of the great Preview->View renaming process. * app/display/gimpdisplayshell-layer-select.c * app/display/gimpnavigationeditor.c * app/widgets/Makefile.am * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpcellrendererviewable.h * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview-dnd.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontainerview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimpnavigationpreview.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimpselectioneditor.c * app/widgets/gimptemplateview.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.c * app/widgets/gimpview.c * app/widgets/gimpview.h * app/widgets/gimpviewablebutton.c * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: Modified accordingly.
2004-08-26 06:31:44 +08:00
gimpview-popup.c \
gimpview-popup.h \
removed the recently added utility functions again. 2004-10-12 Michael Natterer <mitch@gimp.org> * app/tools/gimptooloptions-gui.[ch]: removed the recently added utility functions again. * app/widgets/Makefile.am * app/widgets/gimpviewablebox.[ch] * app/widgets/gimpwidgets-utils.[ch]: and added cleaned up versions here. * app/tools/gimpbucketfilloptions.c * app/tools/gimpclonetool.c * app/tools/gimppaintoptions-gui.c * app/tools/gimptextoptions.c: changed accordingly. * app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead of reinventing the wheel.
2004-10-12 20:06:50 +08:00
gimpviewablebox.c \
gimpviewablebox.h \
added gimp_context_type_to_prop_name(). 2003-04-10 Michael Natterer <mitch@gimp.org> * app/core/gimpcontext.[ch]: added gimp_context_type_to_prop_name(). * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpviewablebutton.[ch]: new widget implementing the wheel-scrollable preview button. * app/tools/gimptextoptions.c * app/tools/paint_options.[ch]: removed the code implementing the same and use GimpViewableButton. * app/tools/tool_manager.c: added the font to the context properties which are remembered per tool. Added an evil hack using g_object_set_data() to pass the global_dock_factory to tool option GUI constructors.
2003-04-10 18:34:56 +08:00
gimpviewablebutton.c \
gimpviewablebutton.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new dialog widget 2002-08-30 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpviewabledialog.[ch]: new dialog widget featuring a title bar containing a stock icon, a description, the viewable's name and a preview. Will be used for all viewable related dialogs and serves as a common place to control their look & feel. * app/tools/gimpimagemaptool.[ch]: removed the code which did almost the same and use GimpViewableDialog. * app/gui/info-dialog.[ch]: extended the API so it has enough information to create a GimpViewableDialog. * app/gui/channels-commands.c * app/gui/convert-dialog.c * app/gui/gradient-editor-commands.c * app/gui/image-commands.c * app/gui/info-window.c * app/gui/layers-commands.c * app/gui/offset-dialog.c * app/gui/qmask-commands.c * app/gui/resize-dialog.c * app/gui/vectors-commands.c * app/tools/gimpcolorpickertool.c * app/tools/gimpcroptool.c * app/tools/gimphistogramtool.c * app/tools/gimpmeasuretool.c * app/tools/gimpperspectivetool.c * app/tools/gimprotatetool.c * app/tools/gimpscaletool.c * app/tools/gimpsheartool.c: use GimpViewableDialogs * themes/Default/gtkrc: apply the dialog style to "*Gimp*Dialog*", not only "*GimpDialog*" so it covers GimpViewableDialog.
2002-08-31 05:00:42 +08:00
gimpviewabledialog.c \
gimpviewabledialog.h \
app/widgets/gimppreview-popup.c renamed these files... * app/widgets/gimppreview-popup.c * app/widgets/gimppreview-popup.h: renamed these files... * app/widgets/gimpview-popup.c * app/widgets/gimpview-popup.h: .. to these files, and changed the GimpPreviewPopup type to GimpViewPopup. * app/widgets/gimppreviewrenderer.c * app/widgets/gimppreviewrenderer.h: renamed these files... * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: .. to these files, and changed GimpPreviewRenderer to GimpViewRenderer. This is the second step of the great Preview->View renaming process. * app/display/gimpdisplayshell-layer-select.c * app/display/gimpnavigationeditor.c * app/widgets/Makefile.am * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpcellrendererviewable.h * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview-dnd.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontainerview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimpnavigationpreview.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimpselectioneditor.c * app/widgets/gimptemplateview.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.c * app/widgets/gimpview.c * app/widgets/gimpview.h * app/widgets/gimpviewablebutton.c * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: Modified accordingly.
2004-08-26 06:31:44 +08:00
gimpviewrenderer.c \
gimpviewrenderer.h \
themes/Default/images/Makefile.am added a stock icon that shows a simple 2004-09-27 Sven Neumann <sven@gimp.org> * themes/Default/images/Makefile.am * themes/Default/images/stock-frame-64.png: added a stock icon that shows a simple drop shadow but could be exchanged for other image decorations. * libgimpwidgets/gimpstock.[ch]: register the new icon. * app/widgets/Makefile.am * app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some ugly code to draw a frame around a preview pixbuf. * app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached to the GimpViewRenderer class so it can be shared by all renderers. * app/widgets/gimpviewrendererimagefile.c: use the new functionality to draw a nice frame around imagefile previews. * app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
2004-09-28 03:40:12 +08:00
gimpviewrenderer-frame.c \
gimpviewrenderer-frame.h \
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 22:20:30 +08:00
gimpviewrenderer-utils.c \
gimpviewrenderer-utils.h \
gimpviewrendererbrush.c \
gimpviewrendererbrush.h \
app/widgets/Makefile.am app/widgets/widgets-types.h added a view renderer 2004-09-14 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer which knows how to preserve a GimpBuffer's aspect ratio if the view's aspect ratio is different. * app/widgets/gimpviewrenderer-utils.c (gimp_view_renderer_type_from_viewable_type): use it for viewables of type GimpBuffer. Fixes bug #152531
2004-09-14 20:06:28 +08:00
gimpviewrendererbuffer.c \
gimpviewrendererbuffer.h \
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 22:20:30 +08:00
gimpviewrendererdrawable.c \
gimpviewrendererdrawable.h \
gimpviewrenderergradient.c \
gimpviewrenderergradient.h \
gimpviewrendererimage.c \
gimpviewrendererimage.h \
gimpviewrendererimagefile.c \
gimpviewrendererimagefile.h \
gimpviewrendererlayer.c \
gimpviewrendererlayer.h \
gimpviewrenderervectors.c \
gimpviewrenderervectors.h \
app/Makefile.am removed. 2001-05-25 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimpui.[ch]: removed. * app/tools/paint_options.[ch]: removed paint_mode_menu_new(). * app/widgets/Makefile.am * app/widgets/gimpwidgets-constructors.[ch] * app/widgets/gimpwidgets-utils.[ch]: added here. * app/disp_callbacks.c * app/errors.c * app/gimphelp.c * app/interface.c * app/gui/brush-select.c * app/gui/channels-commands.c * app/gui/commands.c * app/gui/file-dialog-utils.c * app/gui/file-open-dialog.c * app/gui/file-save-dialog.c * app/gui/layers-commands.c * app/gui/tool-options-dialog.c * app/tools/gimpbrightnesscontrasttool.c * app/tools/gimpbycolorselecttool.c * app/tools/gimpclonetool.c * app/tools/gimpcolorbalancetool.c * app/tools/gimpcolorpickertool.c * app/tools/gimpcurvestool.c * app/tools/gimphistogramtool.c * app/tools/gimphuesaturationtool.c * app/tools/gimplevelstool.c * app/tools/gimpposterizetool.c * app/tools/gimpsmudgetool.c * app/tools/gimptexttool.c * app/tools/gimpthresholdtool.c * app/tools/gimptransformtool.c * app/tools/tool_manager.c * app/widgets/gimplayerlistview.c: changed accordingly.
2001-05-26 00:04:54 +08:00
gimpwidgets-constructors.c \
gimpwidgets-constructors.h \
gimpwidgets-utils.c \
gimpwidgets-utils.h \
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
gtkwrapbox.c \
gtkwrapbox.h \
gtkhwrapbox.c \
gtkhwrapbox.h \
gtkvwrapbox.c \
app/base/Makefile.am automake-1.6 seems to use yet another variable to 2002-06-08 Sven Neumann <sven@gimp.org> * app/base/Makefile.am * app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another variable to pass flags to the assembler (bug #84514). Define AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake. * configure.in * all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a GNU make extension that we don't really need and newer versions of automake don't seem to like it.
2002-06-08 07:00:46 +08:00
gtkvwrapbox.h
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
app/base/Makefile.am automake-1.6 seems to use yet another variable to 2002-06-08 Sven Neumann <sven@gimp.org> * app/base/Makefile.am * app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another variable to pass flags to the assembler (bug #84514). Define AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake. * configure.in * all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a GNU make extension that we don't really need and newer versions of automake don't seem to like it.
2002-06-08 07:00:46 +08:00
libappwidgets_a_built_sources = widgets-enums.c
Makefile.am pre-commit so yosh knows which files to copy :)
2001-04-11 05:33:09 +08:00
app/base/Makefile.am automake-1.6 seems to use yet another variable to 2002-06-08 Sven Neumann <sven@gimp.org> * app/base/Makefile.am * app/paint-funcs/Makefile.am: automake-1.6 seems to use yet another variable to pass flags to the assembler (bug #84514). Define AM_CCASFLAGS like AM_ASFLAGS to satisfy all versions of automake. * configure.in * all Makefiles: removed STRIP_BEGIN and STRIP_END since it's a GNU make extension that we don't really need and newer versions of automake don't seem to like it.
2002-06-08 07:00:46 +08:00
libappwidgets_a_SOURCES = \
$(libappwidgets_a_built_sources) $(libappwidgets_a_sources)
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
[ I've postponed my reservations against pangoft2/fontconfig/freetype2 2003-12-12 Hans Breuer <hans@breuer.org> [ I've postponed my reservations against pangoft2/fontconfig/freetype2 usage, so The Gimp should now build with msvc without patching it. ] * app/makefile.msc app/text/makefile.msc : use $(PANGOFT2_CFLAGS) etc. * libgimpthumb/makefile.msc : (new file) * makefile.msc : added libgimpthumb * libgimpthumb/gimpthumbnail.c : include gimpwin32-io.h * libgimpthumb/gimpthumb-utils.c : don't compare size pointer with GIMP_THUMB_SIZE_FAIL but *size * plug-ins/makefile.msc : handle libgimpoldpreview * plug-ins/common/decompose.c : define cbrt() if not __GLIBC__ * plug-ins/common/winclipboard.c : make it compile without gimpcompat.h * plug-ins/imagemap/imagemap_csim_lex.c : its a generated file but still win32/msvc has no unistd.h * plug-ins/pygimp/makefile.msc : (new file) to use the binary you need to patch glib, see bug #98737 * plug-ins/libgimpoldpreview.c : use <libgimp/gimp.h> instead of "gimp.h" * **/Makefile.am : added makefile.msc to EXTRA_DIST
2003-12-13 09:35:19 +08:00
EXTRA_DIST = makefile.msc
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
#
# rules to generate built sources
#
removed the "truly ugly hack"... 2003-02-03 Michael Natterer <mitch@gimp.org> * app/display/Makefile.am: removed the "truly ugly hack"... * app/Makefile.am: ...and changed the linking order instead. * app/base/Makefile.am * app/core/Makefile.am * app/paint/Makefile.am * app/widgets/Makefile.am: fixed typo.
2003-02-03 21:39:55 +08:00
# setup autogeneration dependencies
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
gen_sources = xgen-wec
CLEANFILES = $(gen_sources)
app/widgets/Makefile.am use gimp_mkenums to create widgets-enums.c, added 2002-03-18 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-enums.[ch]: use gimp_mkenums to create widgets-enums.c, added it to CVS since it contains translatable messages now. * app/widgets/gimpenummenu.[ch]: added new functions gimp_enum_radio_box_new() and gimp_enum_radio_frame_new() that create groups of radio buttons out of enum types. * app/core/core-enums.[ch]: registered more enums. * app/paint/gimpdodgeburn.h * app/tools/gimpbucketfilltool.c * app/tools/gimpdodgeburntool.c * app/tools/gimpmagnifytool.c * app/tools/transform_options.[ch]: use gimp_enum_radio_frame_new() for some tool options.
2002-03-19 06:26:41 +08:00
$(srcdir)/widgets-enums.c: $(srcdir)/widgets-enums.h $(GIMP_MKENUMS)
$(GIMP_MKENUMS) \
include locale.h for setlocale(). 2003-03-25 Sven Neumann <sven@gimp.org> * app/text/gimptext.c: include locale.h for setlocale(). * app/base/Makefile.am * app/core/Makefile.am * app/display/Makefile.am * app/widgets/Makefile.am: changed rules that generate enums code to include gimp-intl.h instead of libgimp-intl.h. * tools/pdbgen/app.pl * tools/pdbgen/pdb/*.pdb: include gimp-intl.h.
2003-03-26 01:39:01 +08:00
--fhead "#include \"config.h\"\n#include <gtk/gtk.h>\n#include \"widgets-enums.h\"\n#include \"gimp-intl.h\"" \
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
--fprod "\n/* enumerations from \"@filename@\" */" \
added still unused flags type GimpDirtyMask. 2004-07-28 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h: added still unused flags type GimpDirtyMask. * app/base/Makefile.am * app/core/Makefile.am * app/display/Makefile.am * app/paint/Makefile.am * app/text/Makefile.am * app/tools/Makefile.am * app/widgets/Makefile.am * libgimpthumb/Makefile.am: changed calls to gimp-mkenums to support GTypeFlags and to make the value arrays private to the get_type() functions. * app/base/base-enums.c * app/core/core-enums.c * app/display/display-enums.c * app/paint/paint-enums.c * app/text/text-enums.c * app/tools/tools-enums.c * app/widgets/widgets-enums.c: regenerated.
2004-07-28 19:50:20 +08:00
--vhead "GType\n@enum_name@_get_type (void)\n{\n static const G@Type@Value values[] =\n {" \
--vprod " { @VALUENAME@, @valuedesc@, \"@valuenick@\" }," \
--vtail " { 0, NULL, NULL }\n };\n\n static GType type = 0;\n\n if (! type)\n type = g_@type@_register_static (\"@EnumName@\", values);\n\n return type;\n}\n" \
register GimpChannelType and GimpSelectionControl enums with the type 2002-03-13 Sven Neumann <sven@gimp.org> * app/core/core-enums.h: register GimpChannelType and GimpSelectionControl enums with the type system. * app/core/gimpimage.c: use them in signal declarations. * app/widgets/Makefile.am * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: split enums into it's own file and generate widgets-enums.c. Register GimpZoomType enum. * app/widgets/gimpnavigationpreview.c: use GIMP_TYPE_ZOOM_TYPE.
2002-03-13 22:51:48 +08:00
$(srcdir)/widgets-enums.h > xgen-wec \
&& cp xgen-wec $(@F) \
&& rm -f xgen-wec